KEGG   Listeria monocytogenes EGD-e: lmo1564Help
Entry
lmo1564           CDS       T00066                                 

Gene name
mutM
Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
lmo  Listeria monocytogenes EGD-e
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:lmo03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(1600975..1601796)
Genome map
AA seq 273 aa AA seqDB search
MPEMPEVENVRATLQELVPGKKIDQVIVRVPKMIVSTPPDEFVHMLVGQEIEGVRRRGKF
LLFDLTNCTILSHLRMEGKFRLMDENEEVSKHTHIIFHFEDHTELRFLDVRKFGTMEVTN
KYGEGETRSIKKLGPEPLTQAFTLTDFATGVKKTSRAIKTALLDQKLVAGVGNIYADEIC
FEAKVRPERAANSLSDKEIKRIFKATKSIMTEAVALGGSTVRTYVNSQGKLGQYQNKLKV
YGKTDEPCVVCGTPIEKIKLNGRGTHFCPNCQK
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgccagaaatgccggaagtagaaaatgtccgcgcaacattacaagaattagtcccaggt
aaaaaaatagatcaagtaatagttcgtgttccaaaaatgattgtctcaacaccacccgat
gagtttgtgcatatgcttgtcgggcaagaaatagagggtgtgcgccgtcgtggtaaattc
ttactttttgacttaaccaactgtacgattttatcgcatttacggatggaaggtaaattt
cggttaatggatgaaaatgaagaggtcagcaagcatacgcatattatttttcattttgag
gatcacacggaattgcgttttttagatgtgcgaaaatttggtacgatggaagtaacgaat
aaatacggtgagggtgagactcggtcgattaaaaagcttggcccagaaccgctgacgcaa
gcttttacactaacggattttgcaactggtgtgaaaaaaacaagccgcgccatcaaaacg
gctttacttgatcaaaagttagtagcgggagttggaaatatttatgcggatgaaatttgt
tttgaagcaaaagtacgaccggaaagagcagctaactcactttcagacaaagaaattaaa
cgtatttttaaagcgacgaaaagtattatgactgaagctgtagcacttggtggctccact
gttagaacgtatgtgaattcgcaaggtaagcttggacaatatcaaaataaattaaaagta
tacggcaaaacagacgagccgtgtgttgtttgtggaacgccgattgaaaaaatcaaatta
aatggacgtgggacacatttttgcccgaattgccaaaaatag

DBGET integrated database retrieval system