KEGG   Listeria monocytogenes EGD-e: lmo1628Help
Entry
lmo1628           CDS       T00066                                 

Gene name
trpB
Definition
(RefSeq) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
lmo  Listeria monocytogenes EGD-e
Pathway
lmo00260  Glycine, serine and threonine metabolism
lmo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lmo01100  Metabolic pathways
lmo01110  Biosynthesis of secondary metabolites
lmo01130  Biosynthesis of antibiotics
lmo01230  Biosynthesis of amino acids
Module
lmo_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lmo00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    lmo1628 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    lmo1628 (trpB)
Enzymes [BR:lmo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     lmo1628 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP DUF1598
Motif
Other DBs
NCBI-GeneID: 985710
NCBI-ProteinID: NP_465153
Pasteur: LMO01628
UniProt: Q8Y6Q6
Position
complement(1670803..1672005)
Genome map
AA seq 400 aa AA seqDB search
MTYQAPDENGFYGKFGGRFVPETLMKAVKELDEAYQASKTDPAFQKELNYYLKEYVGRET
PLYFAEQLTAHAGGAKIYLKREDLNHTGAHKINNTIGQALLARQMGKQKVVAETGAGQHG
VATATVAALFNMKCTIFMGEEDVKRQSLNVFRMELLGAKVVSVKAGSRTLKDAVNEALRF
WVANVEDTHYIMGSVLGPHPFPEIVRDYQSVIGIEARKQHLEKEGKLPDAIVACVGGGSN
AMGLFYPFVDDASVQMHGVEAAGHGLETEFHAATISKGEIGILHGAMMDVLQDENGQILE
AFSISAGLDYPGIGPEHSFFRDLGRAAYHSVTDDEAVEAFQLLCRTEGIIPALESSHAIS
YAVKLASKMRPEESMVVCLSGRGDKDVNQLKERLEGQTND
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgacttatcaagcacctgacgaaaatggcttttacggaaaatttggcggtagatttgta
ccagaaacattaatgaaagcagtgaaagaattagatgaggcgtaccaagcttccaaaaca
gatcctgcttttcaaaaagaattaaactattatttaaaagaatatgtgggccgagaaaca
ccactttattttgccgaacaactaacagcacatgcgggcggagcaaaaatttatttaaaa
cgcgaagatttaaatcatactggcgcacataaaatcaacaatactattggtcaagcctta
ctcgcacgtcaaatgggcaaacaaaaagtagtggcagaaactggtgcgggtcaacacggc
gtggcaacagcaactgttgcagcactttttaatatgaaatgtactatttttatgggagaa
gaagatgtaaaacgtcaatcactcaatgtatttagaatggaacttcttggtgcaaaagta
gtgagcgtgaaagcaggaagcagaacattaaaagatgcagtaaatgaagcgcttaggttc
tgggttgcaaatgtggaagatacgcattacattatgggatctgttcttggaccacaccca
tttccagaaatcgttcgtgattaccaaagtgtaataggaatagaagcacgcaaacaacac
ttggaaaaagaaggtaagcttcctgatgcaattgtagcttgtgttggaggcgggagtaat
gcgatgggcttattttatccatttgtagacgatgcttctgttcaaatgcacggtgtggaa
gcagctggtcacggattagagacagaattccacgcagcaaccatttccaaaggagaaatt
gggattttacacggagcgatgatggatgtattacaagatgagaatgggcaaattttggaa
gcattttcgatttctgctggcttagattatccgggtattggtccagagcatagctttttc
cgtgatttaggtcgcgcagcgtatcattctgttactgatgatgaagcagtcgaagccttt
caacttttatgtcgtacggaaggaattattccagcgctcgaaagttctcacgcaattagc
tatgcggttaaacttgcaagtaaaatgcgtccagaagaaagtatggttgtttgtttatct
ggtcgcggagacaaagacgttaaccaactaaaagaacgtttggagggacaaacaaatgac
taa

DBGET integrated database retrieval system