KEGG   Listeria monocytogenes EGD-e: lmo1663Help
Entry
lmo1663           CDS       T00066                                 

Gene name
ansB
Definition
hypothetical protein
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
lmo  Listeria monocytogenes EGD-e
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lmo00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    lmo1663 (ansB)
Enzymes [BR:lmo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     lmo1663 (ansB)
Peptidases [BR:lmo01002]
 Cysteine Peptidases
  Family C44
   lmo1663 (ansB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(1713234..1715099)
Genome map
AA seq 621 aa AA seqDB search
MCGFVGCVHDRITEITGADKETFRQMNSMITHRGPDDEGYFTDDHVQFGFRRLSIIDVEN
GHQPLTYENERYWIIFNGEVYNYVELREQLVAEGMTFETESDTEVIIATYAKYKEKTAER
LRGMFGFVIWDKQEELVYGARDPFGIKPFFYAEEDDKLFMGSEKKSILHALKEKELDEVS
LQNYMTYQFVPEPDSLTKNVKRLEPGHQFTKKIGQPMEITTYWKASFAPVTKSEDAWIKE
VRDVMYDSVKMHMRSDVPVGSFLSGGIDSSIIAAIAKEYHPAIKTFSVGFERDGFSEIDV
AKETADKLGVENISYVISPEEYMKELPKIVWHMDDPLADPAAIPLYFLSREARKQVTVAL
SGEGADELFGGYNIYNEPNSLAMFNKMPGVFKSMLNNLARIMPEGMRGKSFLERGTTPME
ERYIGNAKMFTEKEKQILLPKYQAGHDYTNITDPFYAETTNYHPVERMQYIDIHTWLRGD
ILLKADRMTMANSLEVRVPFLDKEVYNVARNIPDTMKTTNGTTKYILRKAAATFVPEHVL
NRRKLGFPVPIRHWLKDEMNAWVKNIIKESPTDHLINKQYVLDLLDDHCAGKFDYSRKIW
TVVIFMIWYDVYVADKYDFGK
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggatttgtaggatgcgtacatgaccgcattacagaaattactggcgctgataaa
gaaacctttagacaaatgaacagtatgattacgcaccgtgggccagatgatgaaggatac
ttcacagatgatcacgtgcagtttggtttccgccgtttaagtattattgatgtagaaaac
ggtcatcaaccgttaacgtatgaaaatgaacgttactggattatttttaatggagaagtt
tataactatgtggaactccgcgagcaattagttgctgaaggaatgacatttgaaaccgaa
agtgataccgaagtaattatcgctacatatgcgaaatacaaagaaaaaacagcagaacgc
cttcgcgggatgtttggttttgttatttgggacaaacaagaagaacttgtttacggcgca
cgcgacccattcggcattaaaccatttttctatgcagaagaagacgacaagctgttcatg
ggttctgaaaagaaatccattttacatgcgttaaaagaaaaagaattggacgaagtgtca
ttacaaaactatatgacttaccaatttgttccagaaccagattccttaactaaaaatgtc
aaacgtttagagccaggacatcagtttacgaaaaaaattggtcaaccgatggaaattacg
acttattggaaagcatcttttgcaccagtaactaaatcagaagacgcatggattaaagaa
gtgcgtgacgtgatgtatgattctgttaaaatgcacatgcgctctgatgtgccagttggt
tcattcctatctggcggtattgattcatcgattattgcagcaattgccaaagaataccac
ccagcaatcaaaacattctcagttggttttgaacgcgatggtttcagtgaaatcgatgta
gcaaaagaaacagcggacaaacttggcgtagaaaacattagttatgttatctcaccagaa
gaatatatgaaagaactaccgaaaattgtttggcacatggatgatccacttgctgacccg
gctgctattccgctttatttcttatcaagagaagcgcgcaaacaagtaaccgtagcatta
tcaggtgaaggcgcagatgaacttttcggtggttataacatttataacgaaccaaattcc
cttgcaatgtttaacaaaatgccaggcgtatttaaatcaatgttaaataacttggcgcgt
attatgccagaaggaatgcgtggtaaaagtttcttagaacgtggaacaacgccgatggaa
gaacgttatatcggaaacgccaaaatgttcacggaaaaagaaaaacaaattttacttcca
aaatatcaagctggtcatgactatacgaatattacagatccattttatgcagaaacaacg
aattatcatcctgtagaaagaatgcagtacattgatattcatacgtggcttcgcggagat
attcttctcaaagctgaccgcatgacgatggctaattcgctggaagtccgtgtacctttc
cttgataaagaagtgtacaacgtggcaagaaatattccagatacaatgaaaacaactaat
ggaactactaaatatatcttacgtaaagcggcagcaacatttgtaccagaacatgtactt
aatcgccgtaaactaggattcccagtaccaattcgtcactggttaaaagacgaaatgaac
gcttgggttaaaaatatcattaaagaatcaccaaccgatcatttaattaacaaacaatac
gtgctagacttactagacgatcactgtgccggtaaattcgactacagtcgtaaaatctgg
acagtcgttattttcatgatttggtacgatgtatacgtagcagacaaatacgattttgga
aaataa

DBGET integrated database retrieval system