KEGG   Listeria monocytogenes EGD-e: lmo1827Help
Entry
lmo1827           CDS       T00066                                 

Gene name
gmk
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
lmo  Listeria monocytogenes EGD-e
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:lmo00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    lmo1827 (gmk)
Enzymes [BR:lmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     lmo1827 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1902484..1903101)
Genome map
AA seq 205 aa AA seqDB search
MTERGLLIVLSGPSGVGKGTVREAVFKDPETSFDYSISMTTRLPREGEQDGVDYYFRSRE
VFEQAIKDGKMLEYAEYVGNYYGTPLEYVEEKLAAGVDIFLEIEVQGAMQVRKAMPEGIF
IFLTPPDLSELKNRIIGRGTESMEVVEERMETAKKEIEMMASYDYAVVNDVVANAVQKIK
GIVETEHLKTERVIHRYKKMLEGLQ
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaagaggactgttaattgtactttcaggtccatctggagtaggtaaaggaact
gttcgggaagctgtttttaaagatccggaaacaagttttgattattctatttctatgaca
acgcgtcttccgcgtgaaggcgaacaagacggggtcgattattattttcgttcaagagaa
gtttttgaacaagctatcaaagacggaaaaatgttagaatatgcagagtacgtcggtaat
tattacggcactccgcttgaatatgtcgaggaaaaacttgccgcaggagtggatattttt
ctcgaaattgaagtgcaaggagcaatgcaagttcgaaaagcgatgccagaaggaattttc
attttcttaacgccaccagatttatccgaactaaaaaaccggattatcggtcgcggcaca
gaatcgatggaagttgtcgaggaacgcatggaaacagctaagaaagaaatcgaaatgatg
gcgtcttatgattatgctgtggtgaatgatgttgtagcaaacgccgtacaaaaaatcaaa
ggcatcgtcgaaacagaacacttaaaaactgagcgagtaattcatcgctacaaaaaaatg
ttggagggattacaatga

DBGET integrated database retrieval system