KEGG   Listeria monocytogenes EGD-e: lmo2205Help
Entry
lmo2205           CDS       T00066                                 

Definition
(RefSeq) phosphoglyceromutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lmo  Listeria monocytogenes EGD-e
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lmo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    lmo2205
   01230 Biosynthesis of amino acids
    lmo2205
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lmo2205
  Energy metabolism
   00680 Methane metabolism
    lmo2205
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    lmo2205
Enzymes [BR:lmo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     lmo2205
Exosome [BR:lmo04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   lmo2205
  Exosomal proteins of melanoma cells
   lmo2205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(2293775..2294464)
Genome map
AA seq 229 aa AA seqDB search
MKLVLIRHGQSEWNKLNLFTGWHDVDLSQEGVVEAMTAGKRIKEAGLEFDVAFTSVLTRA
IKTLNYVLEESDQMWVPVHKSWRLNERHYGALQGLNKQETAEKYGADQVQKWRRSYDTLP
PLLEENDERQAKNDRRYQLLDTHAIPSGENLKVTLERVIPYWMDTIAPEIKEGRRVVIAA
HGNSLRALVKFLEGISDDEIMDLEIPTGVPLVYELNADLKPVNKYYLDK
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgaaattagtattaattcgtcatggtcaaagtgaatggaacaaattgaacctatttaca
ggttggcatgatgtggacttgtcgcaagaaggcgttgtggaagcaatgacagcaggaaaa
agaattaaagaggcaggcttagaattcgatgttgccttcacttctgttttaacacgagct
attaaaacacttaattatgtgttagaagaatctgaccaaatgtgggtaccagttcataaa
tcttggcgcttgaacgaacgtcattacggcgcacttcaaggacttaataaacaagaaact
gctgaaaaatatggtgctgaccaagtacaaaaatggcgtagaagctatgacacacttcca
ccattactagaagaaaacgacgaaagacaagcaaaaaatgatcgtcgttatcaactcctt
gatacacacgctattccatcaggtgaaaacttgaaagtaacattagaacgcgttattcct
tattggatggacacaattgctccagaaattaaagaaggacgacgagtagtcatcgcggcg
catggtaacagtttacgagcattagtgaaattcctagaaggtattagtgatgatgaaata
atggatttagaaattccaacaggcgtaccgctagtatatgaattaaacgctgatttaaaa
ccagtaaataaatattacttggataaataa

DBGET integrated database retrieval system