KEGG   Listeria monocytogenes EGD-e: lmo2450Help
Entry
lmo2450           CDS       T00066                                 

Definition
(RefSeq) carboxylesterase
  KO
K03928  carboxylesterase [EC:3.1.1.1]
Organism
lmo  Listeria monocytogenes EGD-e
Brite
Enzymes [BR:lmo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     lmo2450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 Peptidase_S9 DLH BAAT_C FSH1 DUF2048 PSI_PsaE UPF0227 Abhydrolase_4
Motif
Other DBs
NCBI-GeneID: 987389
NCBI-ProteinID: NP_465973
Pasteur: LMO02450
UniProt: Q8Y4I9
Position
complement(2522830..2523576)
Genome map
AA seq 248 aa AA seqDB search
MKITPPQPFLFEKGKRAVLLLHGFTGSSADVRILGRFLQENNYTCYAPQYRGHGVSPDLL
LKTGPNDWWEDVLEAYDHLKSLGYTEIAVAGLSLGGLFSLKLGFSRPLKGIIAMSTPTRM
DSSSPIIQGFLDYVRNYKKLEGKTTEQIDAEMVAYKDAPMNTIAKLKDEISGVVAEIDMI
YAPIMVVQGEKDDMVDVSGAQLIYDTVESTKKELHWFKESGHVITLDKERKEVNQAILTF
LDSLDWQE
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataacaccaccacaaccattcctattcgaaaaaggcaaaagagcagtgttactc
ttacacggtttcacaggtagctcagcggatgtaagaatattaggtaggtttttacaagaa
aacaattacacttgctacgcccctcaatacagaggccacggtgtatctcccgacctactg
ctaaaaacgggaccaaacgattggtgggaagatgttcttgaagcctatgatcacctaaaa
tcactcggctatactgaaatcgctgtggcgggactttcgctcggtggacttttttcacta
aaattaggtttttctaggccgttaaagggaattatagccatgagtactccaacaagaatg
gacagctcatccccgataattcaaggctttttagattatgtgcgtaattataaaaaatta
gaaggtaaaacaactgaacaaatcgatgctgaaatggttgcctataaagacgccccaatg
aataccatcgctaaattaaaagacgagataagtggcgtcgtggctgaaatagatatgatc
tatgcaccaattatggtcgtccaaggtgaaaaagatgatatggttgatgtcagcggagca
cagctgatttatgatacagtagagtcaacgaagaaagaacttcactggtttaaggaatct
ggtcatgtcatcacattagacaaagaacgaaaagaagtaaaccaagccattttaacattt
ttagatagtttggattggcaagaataa

DBGET integrated database retrieval system