KEGG   Listeria monocytogenes EGD-e: lmo2476Help
Entry
lmo2476           CDS       T00066                                 

Definition
(RefSeq) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
lmo  Listeria monocytogenes EGD-e
Pathway
lmo00010  Glycolysis / Gluconeogenesis
lmo00052  Galactose metabolism
lmo01100  Metabolic pathways
lmo01110  Biosynthesis of secondary metabolites
lmo01120  Microbial metabolism in diverse environments
lmo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lmo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lmo2476
   00052 Galactose metabolism
    lmo2476
Enzymes [BR:lmo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     lmo2476
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-GeneID: 987343
NCBI-ProteinID: NP_465999
Pasteur: LMO02476
UniProt: Q8Y4G7
Position
complement(2551234..2552295)
Genome map
AA seq 353 aa AA seqDB search
MIFIEVMKERFGEFEGETVWKWTMINDHDMRMSVLNYGAIVTSLETKDKFGDFANISLGF
TNLDDYLAHSPYFGATLGPVAGRITNGQFSLDGKQFQLIQNEGSNHRHGGKFNFSKKLWD
VSVEKSLDQIVMTFEYCWADGENGYPGKIDAKMTYTLNNKNEWLVDYEARSNQPTIYNPS
NHIYFNLSGEAGSTVLQHQLWVNSDSFLPIDEEFLPIGEKRLAENTIFDLRAGREVAEIT
QSQDQQVKLVGAGLDHTFILKHENGRPDAVLFDPKSGRRLEMETKADSVLIYTANSLDGS
FEIDERAVPKYAGITMETQGLVDAINHEGFGDIVLRPEKPFTSRTAFRFTVES
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
gtgatttttatcgaagtaatgaaggagcgatttggggagtttgaaggagaaactgtttgg
aagtggacgatgataaatgatcatgatatgcgcatgagtgttttaaattacggagcgatt
gttacttcacttgaaacaaaagataaatttggtgattttgcgaatattagtcttggtttt
acaaatttagatgattatttggcacactctccttacttcggcgcgacacttggccctgtt
gctggacgtattacaaatgggcaatttagtttggatggcaaacaatttcaactgattcaa
aatgaaggctctaaccatcgtcacggtgggaaattcaattttagtaagaagctttgggat
gtttcagtagaaaaaagtcttgatcaaattgtgatgacttttgaatactgctgggcggat
ggagaaaatggctatccaggaaaaattgatgcaaaaatgacatatacgttaaataataaa
aatgaatggctggttgattatgaagcgagaagcaatcagccgactatatataacccgagc
aatcatatttattttaatctgagcggagaagctggttcaacggttttacaacatcagctt
tgggtcaatagtgatagcttcctaccaattgatgaagagttcctcccaattggggaaaag
cggttagcggaaaatactatctttgatttgcgtgcaggtcgtgaagtagcggagattaca
caaagtcaggaccagcaagtaaaattagttggtgcggggctggatcatacgttcatttta
aaacatgaaaatggtcgtccagatgcagttttgtttgatccaaagtcaggacggcgcttg
gaaatggaaaccaaagctgactcggtattaatttatacggcgaatagtttggatggctct
tttgagattgacgagcgagctgtgccaaaatatgctggcataacaatggaaacacagggt
ttggtggatgcgattaaccatgagggatttggtgatattgtacttcgaccagaaaaacct
tttacatctagaacagcttttcgtttcacagtggagagctga

DBGET integrated database retrieval system