KEGG   Listeria monocytogenes EGD-e: lmo2546Help
Entry
lmo2546           CDS       T00066                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
lmo  Listeria monocytogenes EGD-e
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:lmo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    lmo2546 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    lmo2546 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    lmo2546 (thrC)
Enzymes [BR:lmo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     lmo2546 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(2622067..2623122)
Genome map
AA seq 351 aa AA seqDB search
MYKGLLEKYKEYLPVTDKTPMISLAEGNTPLIPLPNLSKELGVTLYGKYEGLNPTGSFKD
RGMVMAVAKAKEEGAEAVICASTGNTSAAAAAYATRAGLKAYIVIPEGKVALGKLAQAVM
YGADIISIQGNFDEALKSVRELAETEAVTLVNSVNPYRLEGQKTAAFEICEQLGSAPDVL
AIPVGNAGNISAYWKGFKEWNEAKASGLPRMHGFEAEGAAAIVQGKPIDNPETIATAIRI
GNPASWGLAEAARDESGGYIHSVTDDEIVNAYKKIAAQDGVFIEPGSAASLAGVIQHVAN
GTIKKGETVVCVFTGNGLKDPDTAMSVHEIPISHVDDIEAMRTHLRSGVKA
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtataaaggtttactagaaaaatataaagaatatctaccagtaactgataaaacgcca
atgatctcacttgcggaaggaaatacaccacttattccattaccgaatttgtccaaagaa
cttggggttactttatacggaaaatacgaaggcttaaatccaaccggttcttttaaagat
cgtggaatggttatggctgttgctaaagcgaaagaagaaggtgccgaagcggttatttgt
gcatccactgggaatacttctgctgcggctgcggcatacgcaacacgtgcgggattaaaa
gcgtacattgttattccagaaggcaaagtcgctctaggaaaattagcgcaagcagttatg
tatggcgcagatattatctcgattcaaggtaatttcgatgaagcattaaaatcggttcgt
gaattagctgaaacagaagcagtaacacttgtaaattccgtgaatccatatcgtttagaa
ggtcaaaaaacagctgcattcgaaatctgtgagcaattaggttccgcgccagatgtactt
gcaattccagtcggtaatgccgggaatatttctgcatactggaaggggtttaaagaatgg
aatgaggctaaagcttctggactgccgcggatgcatggttttgaagcagaaggagctgcg
gcgattgttcaagggaaaccaattgataacccggaaacaattgcaacagcgattcgtatc
ggaaacccagctagttgggggcttgcagaagcagctcgcgatgaatctggcggatacatc
cattctgtaacagacgacgaaattgtgaatgcgtataaaaaaattgcagcacaagatggt
gtctttatcgagccgggttctgccgcttcattagctggtgtcattcaacatgtagcaaat
ggaacaattaaaaaaggggaaacagttgtttgtgtctttactggaaatggcttaaaagat
ccagatactgcgatgagtgtgcatgaaattccaatttcccatgtggatgatattgaagca
atgcgcacacatttacgttcaggagtgaaagcttaa

DBGET integrated database retrieval system