KEGG   Listeria monocytogenes EGD-e: lmo2546Help
Entry
lmo2546           CDS       T00066                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
lmo  Listeria monocytogenes EGD-e
Pathway
lmo00260  Glycine, serine and threonine metabolism
lmo00750  Vitamin B6 metabolism
lmo01100  Metabolic pathways
lmo01110  Biosynthesis of secondary metabolites
lmo01120  Microbial metabolism in diverse environments
lmo01230  Biosynthesis of amino acids
Module
lmo_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:lmo00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    lmo2546 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    lmo2546 (thrC)
Enzymes [BR:lmo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     lmo2546 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Peripla_BP_6 PK_C
Motif
Other DBs
NCBI-GeneID: 986503
NCBI-ProteinID: NP_466069
Pasteur: LMO02546
UniProt: Q8Y4A5
Position
complement(2622067..2623122)
Genome map
AA seq 351 aa AA seqDB search
MYKGLLEKYKEYLPVTDKTPMISLAEGNTPLIPLPNLSKELGVTLYGKYEGLNPTGSFKD
RGMVMAVAKAKEEGAEAVICASTGNTSAAAAAYATRAGLKAYIVIPEGKVALGKLAQAVM
YGADIISIQGNFDEALKSVRELAETEAVTLVNSVNPYRLEGQKTAAFEICEQLGSAPDVL
AIPVGNAGNISAYWKGFKEWNEAKASGLPRMHGFEAEGAAAIVQGKPIDNPETIATAIRI
GNPASWGLAEAARDESGGYIHSVTDDEIVNAYKKIAAQDGVFIEPGSAASLAGVIQHVAN
GTIKKGETVVCVFTGNGLKDPDTAMSVHEIPISHVDDIEAMRTHLRSGVKA
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtataaaggtttactagaaaaatataaagaatatctaccagtaactgataaaacgcca
atgatctcacttgcggaaggaaatacaccacttattccattaccgaatttgtccaaagaa
cttggggttactttatacggaaaatacgaaggcttaaatccaaccggttcttttaaagat
cgtggaatggttatggctgttgctaaagcgaaagaagaaggtgccgaagcggttatttgt
gcatccactgggaatacttctgctgcggctgcggcatacgcaacacgtgcgggattaaaa
gcgtacattgttattccagaaggcaaagtcgctctaggaaaattagcgcaagcagttatg
tatggcgcagatattatctcgattcaaggtaatttcgatgaagcattaaaatcggttcgt
gaattagctgaaacagaagcagtaacacttgtaaattccgtgaatccatatcgtttagaa
ggtcaaaaaacagctgcattcgaaatctgtgagcaattaggttccgcgccagatgtactt
gcaattccagtcggtaatgccgggaatatttctgcatactggaaggggtttaaagaatgg
aatgaggctaaagcttctggactgccgcggatgcatggttttgaagcagaaggagctgcg
gcgattgttcaagggaaaccaattgataacccggaaacaattgcaacagcgattcgtatc
ggaaacccagctagttgggggcttgcagaagcagctcgcgatgaatctggcggatacatc
cattctgtaacagacgacgaaattgtgaatgcgtataaaaaaattgcagcacaagatggt
gtctttatcgagccgggttctgccgcttcattagctggtgtcattcaacatgtagcaaat
ggaacaattaaaaaaggggaaacagttgtttgtgtctttactggaaatggcttaaaagat
ccagatactgcgatgagtgtgcatgaaattccaatttcccatgtggatgatattgaagca
atgcgcacacatttacgttcaggagtgaaagcttaa

DBGET integrated database retrieval system