KEGG   Listeria monocytogenes ATCC 19117: LMOATCC19117_0266Help
Entry
LMOATCC19117_0266 CDS       T02239                                 

Gene name
gtfA
Definition
sucrose phosphorylase (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
lmoa  Listeria monocytogenes ATCC 19117
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:lmoa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LMOATCC19117_0266 (gtfA)
Enzymes [BR:lmoa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     LMOATCC19117_0266 (gtfA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
279357..280799
Genome map
AA seq 480 aa AA seqDB search
MQIKNKAMLITYSDSLGKNMEELSKVMETYFEDAVGGIHLLPFFPSTGDRGFAPSDYTTV
DSDLGSWEIIEKLGEKYYLMFDFMINHISRESLFFQDFKKEHLNSKYKDMFIRINDFFPP
GRPNEKDLDLIYKRKDKAPFQEVEFADGGTELVWNTFGEEQIDLDVTAEVTKEFIRQTIK
NMAAHGCSILRLDAFAYAIKKLDTNDFFVEPEIWDLLDEVKAEAAKYDMELLPEIHEHYS
IQMKIANHDYYIYDFALPMVMLYSLYSGRVERLAKWLEMSPMKQFTTLDTHDGIGVVDAR
DLLTDEELDYTSAELYKIGANVKKIYSSEKYNNLDIYQINSTYYSALGDDDKSYLLARVI
QCFAPGIPQIYYVGLLAGKNDIDLLEETKEGRNINRHYYTIDEIKNEVKRPVVKALCNLL
RFRNTSEAFDLEGSIEIETPSSNEIVIIRKNKTNKITATLKANLSTKTFQISENERNILI
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
ttgcaaattaaaaataaagctatgttaattacttattctgatagtttagggaaaaatatg
gaagaattatccaaggtgatggaaacttattttgaagatgctgttggcgggattcactta
ttgccgttctttccatccactggagatcgagggtttgcgccaagtgattacacaacagta
gatagcgacctaggttcttgggaaataatcgagaaattaggcgaaaagtattatttaatg
tttgattttatgattaatcacatttctcgcgaatcactcttctttcaagattttaaaaaa
gagcatttaaactcaaagtataaagatatgtttattcgtatcaatgatttctttcctccg
ggtagaccaaatgaaaaagacttagatttaatttataagagaaaagataaggcgcctttt
caagaagttgaatttgctgatgggggaacggaattagtttggaatacttttggggaagaa
caaattgatttagatgtgacagccgaagttacaaaagaatttattcgtcaaacgataaaa
aatatggctgcacatggttgttctattttgcgtcttgatgcctttgcttatgcaattaaa
aaattagatacaaatgatttttttgtagaaccggaaatttgggatttactggatgaagtg
aaagcagaagcggccaaatatgacatggaattattaccagaaattcatgaacattattcc
atccaaatgaaaatcgcgaaccatgattattatatctatgattttgcgttacccatggtg
atgctgtactcgttatatagtggccgagtggaacgtttagctaaatggttagaaatgagt
ccgatgaagcaatttactactttagatacgcatgatggcattggcgttgtggatgcacgc
gatttattaacagatgaggaactcgattatacttcagcagaattatacaaaataggagct
aatgttaaaaagatatattcctctgaaaaatataataacctggatatttatcaaattaat
agtacctattatagtgctttgggtgacgatgataaaagttacttgttagcgagagtaatt
caatgttttgcgccggggattccgcaaatttattatgttggtttacttgctggcaaaaat
gatattgaccttttagaggaaacaaaagaagggcgtaatattaatcgtcattactacaca
atagatgaaattaaaaatgaagtaaaaagaccagttgttaaagcgttgtgcaatttactg
aggtttagaaatacttctgaagcgtttgatttggaaggaagtatagaaattgagacacct
agctcaaatgaaatcgttattattcgcaaaaacaaaacaaataaaattacagcgacatta
aaagcaaatttaagtactaaaacattccaaatcagcgaaaatgaaagaaatattttaatt
taa

DBGET integrated database retrieval system