KEGG   Listeria monocytogenes ATCC 19117: LMOATCC19117_0281Help
Entry
LMOATCC19117_0281 CDS       T02239                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
lmoa  Listeria monocytogenes ATCC 19117
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:lmoa01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:lmoa00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
301173..302312
Genome map
AA seq 379 aa AA seqDB search
MERQRKIQILKDIVNIDSTNGHEEQVANYLQKLLAEHGIESEKVQYDVDRASLVSEIGSS
DEKVLAFSGHMDVVDAGDVSKWKFPPFEAAEHEGKIYGRGATDMKSGLAAMIIAMIELHE
EKQKLNGKIRLLATVGEEVGELGAEQLTQKGYADDLDGLIIGEPSGHRIVYAHKGSINYT
IKSTGKNAHSSMPEFGVNAIDNLLLFYNEVEKFVKSIDATNEILGDFIHNVTVIDGGNQV
NSIPEKAQLKGNIRSIPEMDNETVKQVLVKIINKLNKQENMNLELIFDYDKQPVFSDKNS
DLVHIAKSVASDIVKEEIPLLGISGTTDAAEFTKAKKEFPVIIFGPGNETPHQVNENVSI
ENYLEMVDVYKRIATEFLS
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggaacgacaaagaaaaattcaaatcttaaaagacattgtgaatattgattcgactaat
gggcatgaagaacaagttgcgaactatttgcaaaagttgttagctgaacacggtattgag
tccgaaaaggtacaatacgacgtagacagagccagcctagttagcgaaattggttccagt
gacgagaaagttttggcgttttcagggcatatggatgtcgttgatgcgggtgatgtctcg
aagtggaagttcccaccttttgaagcagcagagcatgaagggaaaatatacggacgtggc
gcgacggatatgaagtcaggtctagcggcgatgattattgcaatgattgagcttcatgaa
gaaaaacaaaaactaaatggcaaaattagattattagcaacggttggtgaagaagtcggt
gaacttggagccgaacaactaacgcaaaaaggttacgcagatgatttagatggcttgatt
atcggcgaaccgagtggacaccggattgtttatgcgcataaaggttccattaattatacc
attaaatccactggtaaaaatgcgcatagttcgatgccggaatttggtgttaatgcgatt
gacaacttgttgctattttataatgaagtagaaaaattcgtgaaatcaattgatgctact
aacgaaatattaggcgattttattcataatgtcaccgtaattgatggtggaaatcaagtc
aatagtatccctgaaaaagcgcaactaaaagggaatattcgctcgattccagaaatggat
aatgaaacagtgaaacaagtgctagtgaagattatcaataagttaaacaaacaggaaaat
atgaatctagaattaatatttgattatgacaaacaaccagtatttagtgataaaaattcg
gatttagtccacattgctaagagcgtagcaagcgacattgtcaaagaagaaatcccatta
ctcggtatttccggaacaaccgatgcagcagaatttaccaaagctaagaaagagttccca
gtgattatttttggaccaggaaacgaaacccctcaccaagtaaacgaaaatgtttctata
gagaattatttggagatggtagatgtttacaaacgaattgccaccgagtttttatcgtga

DBGET integrated database retrieval system