KEGG   Listeria monocytogenes ATCC 19117: LMOATCC19117_0604Help
Entry
LMOATCC19117_0604 CDS       T02239                                 

Definition
glycosyl hydrolase family protein (EC:3.2.1.-)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lmoa  Listeria monocytogenes ATCC 19117
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:lmoa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMOATCC19117_0604
Enzymes [BR:lmoa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     LMOATCC19117_0604
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
632764..634158
Genome map
AA seq 464 aa AA seqDB search
MTYKFPENFWWGSAASGPQTEGAANVDGRKPSIWDHWYKIEPGRFFNDVGPTNTSNFYYQ
YKEDIALMKQTGHNSFRTSIQWTRLIPDGIGEVNPKAVDFYNRVIDEMLANDVEPFMNLY
HFDMPMSMQEKGGFESREVVDAYATFAKTCFELFGDRVKHWFTFNEPIVPVEAGYLYDMH
YPNVVDFKRATQVAYHTTLAHALAVKEFHALEIPEGQIGIILNLTPSYPRSQNPADLKTA
HIADLIFNRSFLDPVTKGEFPADLVEIIREHDALPEYTEEDLAIIKNNIIDILGVNYYQP
RRVKAKEYATHPDAPFMPEHLFDNYEMPYRKMNPYRGWEIFERAIYDIAINLRDNYDNIP
FFISENGMGVEGESRYRNADGMIEDTYRIDFIKSHLKWLHKAIEEGANCHGYHLWTFMDC
WSWANAYKNRYGLVEVDLDNNFKRTIKASGHWYKELSENNGFED
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgacttataaatttccagagaatttttggtggggaagtgcggcgtccggcccacaaaca
gaaggcgcagcaaatgtagatggcagaaaaccgagtatttgggatcactggtacaaaatc
gaaccaggtcgtttctttaacgatgtaggacctacgaatacatctaatttttactatcaa
tataaagaagatattgctttaatgaaacaaactgggcataattctttccgtacttcgatt
cagtggacacgtcttattccagatggtattggcgaagtgaatccgaaagcggttgatttt
tacaatcgcgttattgatgaaatgcttgcaaatgacgtggaaccatttatgaatttatat
cattttgatatgccaatgtcgatgcaagaaaaaggcggttttgaaagccgtgaagtagtt
gacgcgtatgcaacttttgcgaaaacatgttttgaattattcggagatcgtgtgaaacat
tggtttacttttaatgaaccaattgttcctgttgaagcaggttacttatacgatatgcac
tatccgaatgtcgttgattttaaacgtgcgactcaggttgcttaccatactactttggca
catgcgcttgctgttaaagaattccacgcacttgaaattccagaaggccaaattggaatc
attttaaacttaacaccgtcgtatccaagaagccaaaatccggcagatttaaaaacagct
catattgcggatttaattttcaaccgtagtttccttgatccggttacaaaaggggaattc
ccagctgaccttgttgaaattattcgcgaacatgacgcgcttccagaatatactgaagaa
gatttggcgataattaaaaacaacattattgatattcttggtgtaaactactatcaaccg
cgtcgtgtgaaagcgaaagaatacgcaactcacccggatgcaccatttatgccagaacat
ctttttgataactatgaaatgccttaccgcaaaatgaatccgtaccgtggttgggaaatt
ttcgaaagagcgatttatgatattgcgattaatctgcgtgataactacgataatattcca
ttcttcatttcagaaaatggtatgggtgtggaaggcgaaagtcgctaccgtaatgcagat
ggaatgattgaagacacgtaccgaatcgatttcattaagagtcacttgaaatggcttcat
aaagcaattgaagaaggcgctaattgtcacggttaccacctttggacgttcatggattgc
tggagctgggcgaatgcttacaaaaaccgttatggcttagtagaagttgatttagacaat
aatttcaaacgtactataaaagcatccggacattggtacaaagaactttcagaaaacaat
ggttttgaagactaa

DBGET integrated database retrieval system