KEGG   Listeria monocytogenes ATCC 19117: LMOATCC19117_1346Help
Entry
LMOATCC19117_1346 CDS       T02239                                 

Gene name
glcK
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
lmoa  Listeria monocytogenes ATCC 19117
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lmoa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LMOATCC19117_1346 (glcK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMOATCC19117_1346 (glcK)
   00052 Galactose metabolism
    LMOATCC19117_1346 (glcK)
   00500 Starch and sucrose metabolism
    LMOATCC19117_1346 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    LMOATCC19117_1346 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LMOATCC19117_1346 (glcK)
   00524 Butirosin and neomycin biosynthesis
    LMOATCC19117_1346 (glcK)
Enzymes [BR:lmoa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LMOATCC19117_1346 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1358465..1359433
Genome map
AA seq 322 aa AA seqDB search
MNKKLIGVDLGGTTAKLAILTKEGDIEEKWTIDTNIEDKGAHIVKNIGDSINQKLTDLQL
DNDIFYGIGMGTPGTVNYETGTVKGAYNLGWADEQNVSQDLENITGLKIILDNDANVAAL
GERWKGAGEGGANVVFVTLGTGVGGGIFAEGKILHGIRGAAGEIGHVTVVPENGYDCTCG
KKGCLETVASATGIVRVAKDLAKEYTGKSALKDAINNDETITSKLIFELGAEDDALANET
IDKISFYLALALSHIGNMLNPEKIIIGGGVSAAGDQLLTPVKTYFETMVFPAVKESTKLS
IATKGNDAGIIGAAWLALPSED
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaaaattaattggtgtagatttaggcgggacaacagcaaaattagctatttta
acaaaagaaggcgacattgaagaaaaatggacaattgatacaaatattgaagataagggc
gcccacattgttaaaaacattggggattctatcaatcaaaaattaacggacttacaactg
gataatgatattttttatggtattggtatgggaactccaggtactgtaaattatgaaaca
ggtactgtaaaaggtgcgtacaacttaggctgggcagatgaacaaaatgttagtcaagat
ttagaaaatattactggtttaaaaatcatattagataatgatgctaatgttgccgctctt
ggtgaacgctggaaaggcgcaggcgaaggtggggctaatgtcgttttcgtaacacttgga
acaggcgttggcgggggaattttcgcagaaggcaaaattttacatggtattcgcggagca
gctggtgaaattgggcatgtaacagtagttcctgagaatggttatgattgtacctgtggc
aaaaaaggctgtttagaaactgtcgcatcagcaacaggaatcgttcgagtagcgaaagat
ttagcgaaagagtatactggtaaatccgcacttaaagatgcaataaataacgatgaaaca
attacttctaaattgatttttgaactaggagcagaagatgatgctttagcaaatgaaaca
attgataaaatttctttctatttggctttagcgctcagtcatattggaaacatgttaaat
ccagagaagattattattggtggtggcgtttcagcagcaggcgatcaattattaacaccg
gttaaaacttattttgagacaatggttttcccagctgttaaagaatccactaaattatct
attgcgacaaaagggaatgacgcagggataattggagctgcatggttagcgctaccaagt
gaagattaa

DBGET integrated database retrieval system