KEGG   Listeria monocytogenes ATCC 19117: LMOATCC19117_1542Help
Entry
LMOATCC19117_1542 CDS       T02239                                 

Gene name
ruvA
Definition
holliday junction DNA helicase (EC:3.6.1.-)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
lmoa  Listeria monocytogenes ATCC 19117
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:lmoa03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1560427..1561032)
Genome map
AA seq 201 aa AA seqDB search
MYDYIKGTVTTITPEYIVVEAGQIGYQIITGNPFSFQRLEGTEAQVFLYQHVREDNISLF
GFQTTEERYLFKKLLSVSGIGPKSALAIIASGDVVPLISAIESEDDVYLTKFPSVGKKTA
RQIILDLKGKLADVVASEIVYVAPENDMVAGLSPQLEEAVLALEALGYSTRELKKVIPKL
SKEEDLTSDAYIKLALQLMTK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
ttgtacgattacataaaaggaaccgttacgacgattacacccgaatatattgttgtcgag
gcaggacaaatcggctatcaaataattacaggaaacccgttttcctttcaacgattagaa
ggtacagaagcgcaagtctttttgtatcaacatgtgcgggaggataatatttctctattc
ggttttcaaacaacagaagaacgttatttattcaaaaaattattgagtgtttcgggcatt
ggaccaaaaagcgcgctagctattattgcttcaggcgatgtcgttccactgatttctgct
attgaatccgaagacgatgtttatttaaccaaatttccaagcgttggtaaaaaaacagca
cgccaaatcattcttgatttgaaaggcaaactagctgatgttgtcgcgagcgaaattgtt
tatgttgctccagaaaacgatatggttgctggactttctccgcaattagaagaagctgta
ttagctttagaagcgctcggttatagcacgcgagaactaaaaaaagtaataccaaaattg
tcaaaagaagaagacctaacaagcgacgcatatatcaagctagcactacaattaatgaca
aaatag

DBGET integrated database retrieval system