KEGG   Listeria monocytogenes ATCC 19117: LMOATCC19117_1565Help
Entry
LMOATCC19117_1565 CDS       T02239                                 

Gene name
hemB
Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
lmoa  Listeria monocytogenes ATCC 19117
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lmoa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    LMOATCC19117_1565 (hemB)
Enzymes [BR:lmoa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     LMOATCC19117_1565 (hemB)
Exosome [BR:lmoa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LMOATCC19117_1565 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1582484..1583458)
Genome map
AA seq 324 aa AA seqDB search
MKNQFDRHRRLRKTKTLRDLVRETVLHTDDLIYPIFVKDGKEPKTEVASMPGVFQYPLHE
LEEEMRVVESLGIKAVILFGIPAEKDAVGTQAYHDHGIIQEATRLIKKSFPEILVVADTC
LCEFTDHGHCGVIENGEILNDESLELLKQTAVSQAAAGADIIAPSNMMDGFVQVIREGLD
EAGFYDIPIMSYAVKYASAFYGPFRDAAGSAPQFGDRKSYQMDPANREEALREAMSDEQE
GADFLIVKPSLSYLDIMRDVKNNTNLPVVAYNVSGEYAMVKAAAQNGWIDEEKIVLEMLT
SMKRAGATLIITYFAKDASKYLNK
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatcaatttgatagacatcgtcgtctaagaaaaaccaaaacactgcgtgattta
gtaagagaaacagttttacatacagatgatttaatctatccgatttttgttaaagatggc
aaagaaccaaaaacagaagtagcttctatgcctggggtttttcaatatcctttacatgaa
ctagaagaagaaatgcgcgtagttgagagccttggtattaaagcggttattttatttggt
attcctgccgagaaagacgcagttggcacgcaagcttatcacgaccacggaattattcaa
gaagctacaaggcttataaaaaaaagttttcctgaaattcttgtggtggctgacacatgt
ttatgtgaatttactgatcatggacattgtggtgttattgaaaacggggaaattctcaat
gacgaatcgcttgaattattgaaacaaacagctgtcagtcaagccgctgcaggagcggat
atcattgctccatctaatatgatggatggttttgttcaagtcattcgcgaagggttagat
gaagcgggattttatgatatcccaattatgtcatatgcagttaaatatgcgtctgctttt
tatggaccgttccgtgatgctgctggtagtgcccctcaatttggtgatagaaaatcttat
caaatggatcctgccaatcgtgaagaagctcttcgcgaagcaatgtcggatgaacaagaa
ggtgcagatttccttattgttaaaccatcattatcatacttagatatcatgcgcgatgtt
aagaacaataccaatttaccagtagttgcctacaatgttagtggtgaatatgcaatggta
aaagcagctgcgcaaaatggttggatagatgaagaaaaaattgttttagaaatgctaaca
agtatgaaacgagcgggtgcaacacttatcattacttattttgcaaaagatgcatccaaa
tatttaaataaatag

DBGET integrated database retrieval system