KEGG   Listeria monocytogenes ATCC 19117: LMOATCC19117_1566Help
Entry
LMOATCC19117_1566 CDS       T02239                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
lmoa  Listeria monocytogenes ATCC 19117
Pathway
lmoa00860  Porphyrin and chlorophyll metabolism
lmoa01100  Metabolic pathways
lmoa01110  Biosynthesis of secondary metabolites
lmoa01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lmoa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    LMOATCC19117_1566 (hemD)
Enzymes [BR:lmoa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     LMOATCC19117_1566 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 DUF3916 GP11
Motif
Other DBs
NCBI-ProteinID: CBY70465
Position
complement(1583455..1584177)
Genome map
AA seq 240 aa AA seqDB search
MSKKVVLTREANKNKPWQTYFSQNGFEVTSIPLIKTRPIKMDLSREQQQTDWLFLTSANA
VEYFFTNQHERFNYKIAVIGEKTKEKLAEFGHEPNFVPSIYQSEVFLEEWLNENPEKTSI
LIPQSNLSRTIIKDRLIEKGYIVVSFELYETIFPENSKIRLIEQLKLNETQIIVFASPSA
WKNFYSTAKSFPAQKEKWHIASIGSITTEAIIADGWEVKYQPKTFTMKHLADLIIQEELK
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaaaagttgttttaacaagagaagcgaataaaaacaaaccatggcaaacctat
ttttcgcaaaatggttttgaagtgacgtcaatcccgctgattaaaacacgacctataaaa
atggatttgagtcgagaacaacaacaaacagactggctttttttaacaagtgcaaatgct
gtagaatatttctttacgaaccaacatgaaagattcaattataaaatagctgtcatcggt
gaaaaaacaaaagaaaaactggcagaatttggtcacgaaccaaattttgtcccatctatc
tatcagtcagaagtatttttagaagaatggctaaacgaaaacccagagaaaacaagtatc
ttaataccacaaagtaatttaagcagaacaataataaaagatagattgattgaaaaaggt
tacatcgttgtttcgtttgagctctatgaaacaatctttccagaaaattctaaaatacgg
ttaatcgaacaactgaaactaaatgaaacacaaataattgtttttgccagcccatctgca
tggaaaaacttctattccactgcgaagtcattccctgctcaaaaagagaagtggcatatt
gcatccattggtagtattacaacagaagccattatagcagatggatgggaagtaaaatat
caaccaaaaaccttcaccatgaagcacctagctgatttgataatacaggaggaattaaaa
tga

DBGET integrated database retrieval system