KEGG   Listeria monocytogenes ATCC 19117: LMOATCC19117_2115Help
Entry
LMOATCC19117_2115 CDS       T02239                                 

Definition
class II aldolase/adducin domain-containing protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
lmoa  Listeria monocytogenes ATCC 19117
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lmoa00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    LMOATCC19117_2115
Enzymes [BR:lmoa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     LMOATCC19117_2115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2174822..2175472)
Genome map
AA seq 216 aa AA seqDB search
MLYQKEREDLAKIVKTMFDRFETNAAGGNVSVRMNNEHIIMTPTLMSQAKLCDLSPYEIL
VVDNNNEVVEGDGRVTREINLHRACYVENPKIGCVLHAHPKESMLFATLGMELPNLTEAT
QKIGQIPTLEFAPATSPELAEIVRKHVIELGDKAVPSASLLNKHGIVVLDTSLHKAYDML
ERIEYNAYIAEKALVFDALGIKKLAHDRELNYNLEE
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgttataccaaaaagaacgtgaagatttagcaaaaatagtgaagacgatgtttgaccgc
tttgaaacgaatgcagctggaggaaatgtaagtgtgcgcatgaataatgagcacattatt
atgacacctacactcatgagtcaagcaaaactttgcgatctttccccatatgaaatcctt
gtagtggataataacaatgaagtcgtagaaggcgatgggagagttactagagaaattaac
ttacaccgcgcttgttacgtagaaaatccaaaaattggctgtgtactccatgctcatcca
aaagaatcgatgctatttgccacacttggaatggaattaccgaatttaacagaagcaacg
caaaaaattggccaaattccaacacttgaatttgcgccagcgactagtccagaacttgcg
gaaatcgttcgtaaacacgttatcgaactaggagataaagctgttcctagtgcaagttta
ttaaataaacacggtattgtcgtattagatacatcacttcataaagcatacgacatgcta
gagcgtattgaatacaatgcctatattgcagaaaaagcgttagtatttgatgcgttaggt
ataaaaaaattagctcatgaccgcgaattaaattataatttggaggagtaa

DBGET integrated database retrieval system