KEGG   Listeria monocytogenes ATCC 19117: LMOATCC19117_2466Help
Entry
LMOATCC19117_2466 CDS       T02239                                 

Gene name
tpi
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lmoa  Listeria monocytogenes ATCC 19117
Pathway
lmoa00010  Glycolysis / Gluconeogenesis
lmoa00051  Fructose and mannose metabolism
lmoa00562  Inositol phosphate metabolism
lmoa01100  Metabolic pathways
lmoa01110  Biosynthesis of secondary metabolites
lmoa01120  Microbial metabolism in diverse environments
lmoa01130  Biosynthesis of antibiotics
lmoa01200  Carbon metabolism
lmoa01230  Biosynthesis of amino acids
Module
lmoa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lmoa_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lmoa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMOATCC19117_2466 (tpi)
   00051 Fructose and mannose metabolism
    LMOATCC19117_2466 (tpi)
   00562 Inositol phosphate metabolism
    LMOATCC19117_2466 (tpi)
Enzymes [BR:lmoa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LMOATCC19117_2466 (tpi)
Exosome [BR:lmoa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LMOATCC19117_2466 (tpi)
  Exosomal proteins of bladder cancer cells
   LMOATCC19117_2466 (tpi)
  Exosomal proteins of melanoma cells
   LMOATCC19117_2466 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CBY71365
Position
complement(2544558..2545313)
Genome map
AA seq 251 aa AA seqDB search
MRKPIIAGNWKMNKTAAKAGQFAEDVKNNVPSSDAVESVVAAPALFLQELVRLTEGTNLR
VAAQNCYFEDEGAFTGEISPFALADLGVSYVIIGHSERREYFHETDEDINKKAHAIFKHG
MTPIICCGETLDQREAGQTDTWVRGQIRAALAGLTEEQVIKSVIAYEPIWAIGTGKSSTS
ADANETCAVIRAEVADAVSQKAADAVRIQYGGSVKPENIADYLAESDIDGALVGGASLEP
ASFLALLEAVK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaccaattattgctggtaactggaaaatgaacaaaactgctgcaaaagcagga
caatttgcagaagacgtaaaaaataacgtgccatcaagcgatgctgttgaatcagtagtt
gctgcaccggcgctatttttacaagaattagttcgtcttactgaaggaactaatcttcgc
gtagctgcacaaaactgttattttgaagacgaaggtgctttcactggcgaaattagcccg
tttgcacttgctgatttaggtgtttcttatgttattatcggacactctgaacgtcgtgag
tatttccacgaaacagacgaagatattaacaaaaaagcacatgcaatcttcaaacacggc
atgacaccaatcatttgctgtggtgaaacattagatcaacgtgaagctggtcaaacagat
acttgggtacgtggtcaaatccgtgcagctcttgctggattaacggaagaacaagtaatc
aaatctgttattgcttatgaaccaatttgggcaatcggtactgggaaatcttccacaagt
gctgatgcaaacgaaacttgtgcagttattcgtgcagaagttgcagacgctgtatctcaa
aaagcagcagacgcagttcgtattcaatacggcggtagcgtaaaacctgaaaacattgct
gattatcttgcagagtccgacattgacggcgctcttgtaggtggagcaagcttagaacca
gcatcgttcttagcattattggaggcagtaaaataa

DBGET integrated database retrieval system