KEGG   Listeria monocytogenes ATCC 19117: LMOATCC19117_2785Help
Entry
LMOATCC19117_2785 CDS       T02239                                 

Gene name
bglA
Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lmoa  Listeria monocytogenes ATCC 19117
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lmoa00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2864420..2865868)
Genome map
AA seq 482 aa AA seqDB search
MSNTKFPDGFMWGGATAANQFEGGYNLGGKGLACADLFTGGTHTEPRRITAQLEESTFYP
SHEAVDFYHHYKEDIKLMAEAGFKVFRMSINWTRIFPTGKEAEPNEEGLQFYEDVFKELK
KYQIEPLVTIAHFDIPLALTNEVNGWASRDLIDYYLHYCEVIFKRYKHLVKHWLTFNEIN
TATMEIGNYLSLGIRHAEGDFLHQKDDPTVRYQALHHQFVASAKAVKLGHSINPEFMIGC
MIAYMPRYPRTCEPTDVLLAKQTEAMHSHFCGDVHVKGYYPFYAKTFFKDNGIELEFDPE
DEQVLREGTVDFYTFSYYLTLCASNDPAYKNSGKSVIGGAENPYLKTNDWGMQTDPVGLR
IALNDLYTRYNIPLMVVENGLGAFDKLEDDGTINDPYRIDYFKEHILQMHKAIQDGVDLI
GFTIWGCIDLVSASTGEMAKRYGIIYVDKYDDGTGDYSRKKKASYYWYKDVISSNGEIGL
RE
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatacgaagtttccagatggctttatgtggggcggggcgaccgcggctaaccag
tttgaaggtggttataatttaggcggaaaagggcttgcctgtgcggatttattcactggt
ggaacgcatacagagccaagaagaattaccgcacaattagaagaatccactttttatcca
agtcatgaagcagtggacttttatcatcattataaagaggatattaagttaatggcagaa
gctggatttaaagtgttccggatgtccataaactggactcgtattttcccgacaggaaag
gaagcagagcctaacgaggaaggattacagttttatgaagatgtttttaaggagctgaaa
aaatatcagattgaaccgttagtgacgattgctcattttgatattccgctagcattaacg
aatgaggtgaacggctgggcgtcgcgtgatttgattgattactatcttcattattgtgaa
gtgatttttaaacgctataaacatttagtaaaacactggttgacgttcaatgaaataaat
actgcaacaatggaaattgggaattatttatcgcttggcattcgtcatgcggagggagat
ttccttcatcaaaaagatgacccaacagtgagatatcaagcccttcatcatcaatttgtt
gctagtgcaaaagcggtaaaactaggccatagcatcaacccagaattcatgattggctgc
atgattgcttatatgccacgctacccgcgtacttgcgaaccaactgatgtcttgttggct
aagcaaacggaagcaatgcacagccatttctgcggcgacgttcatgtcaaagggtattat
cctttttatgcaaaaacattctttaaagataatggtattgagcttgaatttgacccagaa
gatgaacaagttttgcgagaaggcacggttgatttttatacttttagctattatttaacg
ctttgtgcatccaacgatcctgcctataaaaattcgggaaaaagtgttattggaggggct
gaaaatccttatttaaaaacaaatgattggggaatgcagacagatcctgtagggcttcgg
attgcactgaatgatttatatactcgctataatattccgcttatggtagttgaaaatggt
ttaggagcctttgataaattggaagacgatgggacgattaatgatccgtatcgaattgat
tatttcaaagaacatattcttcaaatgcataaagcaattcaagatggtgtagatttgatt
ggatttactatttggggttgtattgacctagtgagcgcatctacaggggaaatggccaaa
cgttatggtattatttatgtggataaatacgatgatggaaccggtgattattcgcgtaaa
aagaaagcatcctattattggtataaagatgtgattagttcaaatggtgaaattggattg
agagagtaa

DBGET integrated database retrieval system