KEGG   Listeria monocytogenes N53-1: BN419_1297Help
Entry
BN419_1297        CDS       T02513                                 

Definition
5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
lmob  Listeria monocytogenes N53-1
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:lmob00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:lmob00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1042814..1043374
Genome map
AA seq 186 aa AA seqDB search
MEIVESKLAGVKLVKPKVFGDHRGFFMESYNEKAFHEAGIDMKFIQDNHSLSVEAGVLRG
MHYQTNPKAQTKLIRVATGAIYDVVVDMRKGSPTYGEWEGYILSEANKHQLLVPQGFAHG
FCTITENVNVLYKVDQLYSPENDAGIAYDDPDLNITWPTDKLILSDKDTKHPRLKDAENN
FVWENK
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atggaaattgttgaaagtaaactagctggtgttaaattagtaaaaccaaaagtgtttgga
gatcatcgtggttttttcatggaaagctataatgaaaaagcattccatgaagctggaatc
gatatgaagtttattcaagataaccactctctttctgtggaagcgggtgtacttcggggt
atgcattatcaaacgaacccaaaagcacagacaaaattaattcgtgttgcgacaggcgca
atttatgatgtagttgttgatatgcgtaaaggttctcctacatacggtgagtgggaaggt
tatattttaagcgaagcaaacaaacatcaacttctagtaccacaaggatttgctcatggc
ttttgtacgattaccgaaaatgtgaatgtgctttataaagtagatcaattatattcccct
gaaaacgatgcgggaattgcctacgatgatccggatttaaatattacttggccaacagat
aaattaattttatcggacaaggatacgaaacatccacgtttaaaagacgctgaaaataat
tttgtatgggagaataaataa

DBGET integrated database retrieval system