KEGG   Listeria monocytogenes N53-1: BN419_1408Help
Entry
BN419_1408        CDS       T02513                                 

Definition
Uroporphyrinogen-III synthase
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
lmob  Listeria monocytogenes N53-1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lmob00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BN419_1408
Enzymes [BR:lmob01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     BN419_1408
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     BN419_1408
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1124022..1125503
Genome map
AA seq 493 aa AA seqDB search
MGKVMLIGAGPGDAQLLTVKGLAALQKADVIVYDRLVEPAMLQERKASCKLIYVGKEPLH
HPIPQDEIERILVREAATNELVVRLKAGDPYVFGRGGEEGETLHKAGIPFEVIPGITSAI
GGLAYAGIPVTHRDFASSFHVITGHLKKGRDPLDWEALARLEGTLVFLMGMTNLPNICAN
LLEHGQKPETGVAIVQWATRGKQLTVTGNLQTIEQKVAESGISSPALIVVGDVVSLRPQL
NFFEETPLFHTKVLLPRARAGKSMLAEQIRDLGGEVTMYPNIQVLDVAPTKTKEQLSEVS
ELLFTSKEAVERFFDYLAKLDLDIRSLKNSHLTAIGKQTKEAFSEKGIIPDSFIKRRSTE
LILEHLPRLQKNVSNLIIGSVVDTTEVNVILADVKTIEMMPLYDMRPVTERPFDLESFEQ
VCFSSSRSVQNLLDVLTIEEKAILQTKTILSIGRFTSATLASFGMNNFIEAESATPESLI
ELIQKTKLEGVPQ
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaagttatgttaattggtgcagggcctggggatgcgcaactactgacagtgaaa
ggtttagctgcactacaaaaggcagatgttattgtttacgatcgcctcgtcgaaccagcg
atgctccaagaacgaaaagctagttgtaaactaatttatgttggaaaagaaccacttcat
catccaattccacaagatgaaatcgaacgaattcttgtaagagaagcggcaacgaatgag
cttgtcgtccgtttaaaagcaggtgatccttatgtatttggacgaggtggcgaagaagga
gagacactccataaagcaggaattccgtttgaagttatccctggaatcacttcagctatt
ggtgggctcgcctatgctggaatccctgtaacacatcgtgattttgcttcaagttttcat
gtcattaccggacatttgaagaaagggcgcgatccactagattgggaagcacttgctaga
ctggaaggtacacttgttttcttaatggggatgactaatttacctaatatctgtgcgaat
ttattagaacacggtcaaaagccagaaactggtgttgcaattgtacaatgggcaactcga
ggcaaacaattaacagtaactggaaatttgcaaaccatcgaacaaaaagtagctgagtcg
ggtatttcctctccagcacttatcgttgttggcgatgtagttagcttacgaccacaactg
aacttttttgaggaaacgccactttttcataccaaagtattacttccaagagcacgagca
ggaaagagtatgctcgcggaacaaattcgtgatttaggcggagaagtaacaatgtaccca
aatattcaagtattagatgttgcgccaacgaaaacaaaagaacaactaagcgaagtaagc
gaactgcttttcacatcaaaagaagctgtagaacgattttttgattatttagccaagctt
gatttagatattcgttctcttaaaaatagccatctgacggctattggcaagcaaacgaag
gaagcatttagcgaaaaaggaattattccagatagttttattaaaagacggagcacggaa
ttgattttagagcatttaccacgattacagaaaaatgtgagtaatttaattatcggaagc
gtagttgatacgaccgaagttaatgttattttagctgatgtaaaaactattgaaatgatg
ccgttatatgatatgcgcccagtgacagaacgaccatttgatctcgaaagctttgaacaa
gtatgtttttcaagttcgcgttccgtccaaaatctacttgatgtactaacaatagaagaa
aaggcgattttacaaacgaaaacaatcctttcgattggaaggttcacgagcgcaacttta
gcgtcattcggtatgaacaatttcatagaagccgaaagcgccacaccagagagcttaatc
gaactaatccaaaaaacaaaattagaaggagtaccacaatga

DBGET integrated database retrieval system