KEGG   Listeria monocytogenes N53-1: BN419_1815Help
Entry
BN419_1815        CDS       T02513                                 

Definition
Putative uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
lmob  Listeria monocytogenes N53-1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:lmob00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1486258..1486980)
Genome map
AA seq 240 aa AA seqDB search
MSKKVVLTREASKNKPWQTYFSQNGYEVMSIPLIKTQPIKINLSREQQETDWLFLTSANA
VEYFFTNQYERSNYKIAVIGEKTKEKLAEFGHEPSFVPSIYQSEVFLEEWLNENPEKTSI
LLPQSNLSRTIIKDTLIEKGYIVFSIELYETIFPEASKKLLTEQLKLNETQIIVFASPSA
WKNFYSIAKSFPAQKEKWHIASIGSITTEAILADGWEVKYQPKTFTMKHLADLIIQEELK
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaaaagttgttttaacaagagaagcgagtaaaaacaaaccatggcaaacctat
ttttcacaaaatggttatgaggtgatgtccatcccgcttattaaaacacaacctataaaa
attaatttgagccgagaacaacaagaaacagactggctttttttaacaagtgctaatgct
gtagaatatttcttcacgaaccaatatgagagatccaattacaaaatagctgtcatcggc
gaaaaaacaaaagaaaagttggcagaatttggtcacgaaccaagttttgtcccatctatc
tatcagtcagaagtatttttagaagaatggttaaacgagaacccagagaaaacaagtatc
ttactaccacaaagtaatttaagcagaacaataataaaagatacattgatagaaaaaggt
tatatcgttttttcgattgagctctacgaaacaatttttccagaggcttcaaaaaaactg
ttaaccgaacaactgaaactaaatgaaacacaaataattgtttttgccagcccatctgca
tggaaaaacttctattccatcgcgaaatcattccctgctcaaaaagagaagtggcatatc
gcatcaattggtagtattacaacagaggccattctagcagatggatgggaagtaaaatat
caaccaaaaaccttcaccatgaagcacctagctgatttgataatacaggaggaattaaaa
tga

DBGET integrated database retrieval system