KEGG   Listeria monocytogenes N53-1: BN419_1815Help
Entry
BN419_1815        CDS       T02513                                 

Definition
(GenBank) Putative uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
lmob  Listeria monocytogenes N53-1
Pathway
lmob00860  Porphyrin and chlorophyll metabolism
lmob01100  Metabolic pathways
lmob01110  Biosynthesis of secondary metabolites
lmob01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lmob00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BN419_1815
Enzymes [BR:lmob01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     BN419_1815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: CCQ24133
Position
complement(1486258..1486980)
Genome map
AA seq 240 aa AA seqDB search
MSKKVVLTREASKNKPWQTYFSQNGYEVMSIPLIKTQPIKINLSREQQETDWLFLTSANA
VEYFFTNQYERSNYKIAVIGEKTKEKLAEFGHEPSFVPSIYQSEVFLEEWLNENPEKTSI
LLPQSNLSRTIIKDTLIEKGYIVFSIELYETIFPEASKKLLTEQLKLNETQIIVFASPSA
WKNFYSIAKSFPAQKEKWHIASIGSITTEAILADGWEVKYQPKTFTMKHLADLIIQEELK
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaaaagttgttttaacaagagaagcgagtaaaaacaaaccatggcaaacctat
ttttcacaaaatggttatgaggtgatgtccatcccgcttattaaaacacaacctataaaa
attaatttgagccgagaacaacaagaaacagactggctttttttaacaagtgctaatgct
gtagaatatttcttcacgaaccaatatgagagatccaattacaaaatagctgtcatcggc
gaaaaaacaaaagaaaagttggcagaatttggtcacgaaccaagttttgtcccatctatc
tatcagtcagaagtatttttagaagaatggttaaacgagaacccagagaaaacaagtatc
ttactaccacaaagtaatttaagcagaacaataataaaagatacattgatagaaaaaggt
tatatcgttttttcgattgagctctacgaaacaatttttccagaggcttcaaaaaaactg
ttaaccgaacaactgaaactaaatgaaacacaaataattgtttttgccagcccatctgca
tggaaaaacttctattccatcgcgaaatcattccctgctcaaaaagagaagtggcatatc
gcatcaattggtagtattacaacagaggccattctagcagatggatgggaagtaaaatat
caaccaaaaaccttcaccatgaagcacctagctgatttgataatacaggaggaattaaaa
tga

DBGET integrated database retrieval system