KEGG   Listeria monocytogenes N53-1: BN419_2911Help
Entry
BN419_2911        CDS       T02513                                 

Definition
(GenBank) Carboxylesterase
  KO
K03928  carboxylesterase [EC:3.1.1.1]
Organism
lmob  Listeria monocytogenes N53-1
Brite
Enzymes [BR:lmob01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     BN419_2911
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 Peptidase_S9 DLH BAAT_C FSH1 DUF2048 PSI_PsaE UPF0227 Abhydrolase_4
Motif
Other DBs
NCBI-ProteinID: CCQ25123
Position
complement(2369111..2369857)
Genome map
AA seq 248 aa AA seqDB search
MKITPPQPFLFEKGKRAVLLLHGFTGSSADVRILGRFLQENNYTCYAPQYRGHGVSPDLL
LKTGPNDWWEDVLEAYDHLKSLGYTEIAVAGLSLGGLFSLKLGFSRPLKGIIAMSTPTRM
DSSSPIIQGFLDYVRNYKKLEGKTTEQIDAEMVAYKDAPMNTIAKLKDEISGVVAEIDMI
YAPIMVVQGEKDDMVDVSGAQLIYDTVESTKKELHWFKESGHVITLDKERKEVNQAILTF
LDSLDWQE
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataacaccaccacaaccattcctattcgaaaaaggcaaaagagcagtgttactc
ttacacggtttcacaggtagctcagcggatgtaagaatattaggtaggtttttacaagaa
aacaattacacttgctacgcccctcaatacagaggccacggtgtatctcccgacctactg
ctaaaaacgggaccaaacgattggtgggaagatgttcttgaagcctatgatcacctaaaa
tcactcggctatactgaaatcgctgtggcgggactttcgctcggtggacttttttcacta
aaattaggtttttctaggccgttaaagggaattatagccatgagtactccaacaagaatg
gacagctcatccccgataattcaaggctttttagattatgtgcgtaattataaaaaatta
gaaggtaaaacaactgaacaaatcgatgctgaaatggttgcctataaagacgccccaatg
aataccatcgctaaattaaaagacgagataagtggcgtcgtggctgaaattgatatgatc
tatgcaccaattatggtcgtccaaggtgaaaaagatgatatggttgatgtcagcggagca
cagctgatttatgatacagtagagtcaacgaagaaagaacttcactggtttaaggaatct
ggtcatgtcatcacattagacaaagaacgaaaagaagtaaaccaagccattttaacattt
ttagatagtttggattggcaagaataa

DBGET integrated database retrieval system