KEGG   Listeria monocytogenes N53-1: BN419_3255Help
Entry
BN419_3255        CDS       T02513                                 

Definition
Putative sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
lmob  Listeria monocytogenes N53-1
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:lmob00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BN419_3255
Enzymes [BR:lmob01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     BN419_3255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2649986..2651668
Genome map
AA seq 560 aa AA seqDB search
MQTELVNQIEVKLRKIYQAAYQPAYLEKMLACAENYSNNTRGSIDTISEKNVYLIAYGDS
IFEKNKHPLQTLNEFLQEYAQDVITDVHLLPIFPSTSDDGFSVTDYKQIDEQLGDWDDVQ
KMSENFRVMLDFVANHMSKSSDWFKRFSDNEAPYNQFFIEKDSQFDYKNVTRPRTSPLFH
KYENGKELWTTFSEDQLDLNVRNIDCLVALTDVLLFYASKQATSIRLDAIGFLWKTSGTT
CMHLPETHEIISLWRLLIDELYPNLQIITETNVPHEENISYFGDGENEANMVYQFPLPPL
VLHTFTCHDTTKLSKWAKSISQVSDTATYFNFLASHDGIGMRPATGILSDEEINSLVQKA
VQNGGQVSYKDNADGTQSVYELNINYGEALQNLDEDTTEELVTKKIIAAHSILLTLQGVP
AIYYHSLLGSKNDLVGYEESGINRRINREKLEKNQLVHELKTDTYRKTIFTSLKKLVQIR
RNHTAFSPFATQEILDLGPDVFAIKRESEGECIYGIINVTSHDISKKVAFSGTNLLANQP
VTSELELTAYEVVWIKKAVQ
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccgaactggttaatcaaatagaagtaaaactaagaaaaatttatcaagccgca
taccaacccgcatacttggaaaaaatgctcgcatgcgctgaaaactattctaataatacg
cgtggttcgattgatactatttccgaaaaaaacgtctatcttattgcttatggtgacagc
attttcgaaaaaaacaagcatccgttacaaacattaaatgagttcctacaagaatatgca
caagatgttattacagacgtccacttactaccgattttccctagtacgtcagatgatggc
ttctctgtcacagactacaagcaaattgacgaacagcttggcgactgggatgacgttcaa
aaaatgtctgagaacttccgagtgatgcttgatttcgtagccaatcatatgtcgaaatca
agtgattggttcaagcgattctccgataatgaagcgccgtacaatcaatttttcattgag
aaagacagccaatttgattataaaaatgttactcgcccgcggacttctccgctgttccac
aaatacgaaaacggcaaggaactttggactacttttagcgaagaccagttagacttaaat
gtccgtaatatcgattgccttgtagccttaacagatgtcctgcttttctatgcatccaaa
caagcgacaagcattcgtcttgatgctattggatttttatggaaaacatctggcacgact
tgtatgcacctaccagaaacgcatgagatcatttcgctttggcgtctgctgattgatgag
ctatatccgaatctgcaaattatcacagaaaccaacgtccctcatgaagaaaacattagt
tattttggcgatggcgaaaatgaagcaaatatggtttatcagttcccgcttccgccactt
gtgctccataccttcacttgccatgatacaacgaaactttcgaagtgggcgaaatccatt
tcacaagtttctgacacagcgacttattttaacttcttagcaagtcatgacggaattggt
atgcgccctgcgaccggaattctttccgacgaagaaatcaattctctcgtccaaaaagcg
gtccaaaacggtggacaagtttcctataaagacaatgcagatggcacgcagtcggtatat
gaacttaatattaactacggtgaagccttgcaaaatctagacgaagacacaaccgaagaa
ctcgtaacaaagaaaattatcgctgctcacagtattttactaacacttcaaggtgtccca
gcgatttactatcattcccttctaggctcaaaaaacgaccttgttggttatgaagaatca
ggtattaatcgtcgaattaaccgtgaaaaactggaaaaaaatcaattggttcatgaactt
aaaacagacacttatcgcaaaaccattttcacatcgctgaaaaaattggtgcaaatcaga
cgaaaccacaccgctttttcaccatttgcaacccaagaaattttagatttaggaccagat
gtttttgcgataaaacgggaatctgagggagaatgcatttatggaatcatcaacgttact
tctcacgatatcagcaaaaaagtcgctttctctggcactaatttgttagccaatcaaccc
gttacgagtgagctcgaattaactgcatatgaagttgtctggattaagaaggcggtccaa
tga

DBGET integrated database retrieval system