KEGG   Listeria monocytogenes SLCC5850: LMOSLCC5850_0560Help
Entry
LMOSLCC5850_0560  CDS       T02223                                 

Gene name
hisD
Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
lmoc  Listeria monocytogenes SLCC5850
Pathway
lmoc00340  Histidine metabolism
lmoc01100  Metabolic pathways
lmoc01110  Biosynthesis of secondary metabolites
lmoc01230  Biosynthesis of amino acids
Module
lmoc_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:lmoc00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    LMOSLCC5850_0560 (hisD)
Enzymes [BR:lmoc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     LMOSLCC5850_0560 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: CBY51029
Position
complement(583820..585103)
Genome map
AA seq 427 aa AA seqDB search
MKILTGTINELLNEFKAENNTNNSLQVESEVKSIIEKVKKDGDQALFDFTSQFDGVRLTE
LRVQTADIQSASSKVDPAFLVALQQAKANIESFHSKQKQHAFLDSEKDGVIRGQLIRPLE
TVGIYVPGGTAAYPSSVLMNVLPAKIAGVKRIVMITPPAENGINPHVLAAAQLAGVDEIY
QVGGAHGIAALAHGTESIPKVDKIVGPGNIYVATAKREVFGLVDIDMIAGPSEIVVLADE
NANPAFIASDLLSQAEHDILARAILITTSKKIAEETQNEINKQLENLPRKAIAQKSIETQ
GKIIIAANTQEMFDIMNEIAPEHLEVQLENPMNYLNQIKNAGSIFLGSYASEPLGDYFAG
PNHVLPTSGTAKFFSPLGVEDFTKRSAFISYTKEALAKEKDAIVLLAKKEGLDAHAKAIQ
IRFEEEN
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattttaaccggaacaataaacgagctattaaacgaattcaaagcagaaaacaat
accaataattcactccaagtcgaatccgaagtaaaatcgattatcgaaaaagtaaaaaaa
gatggcgaccaagccctgtttgacttcacatcccagtttgacggcgtacggctcaccgaa
ctacgcgtccagaccgctgacatccaaagtgcaagttccaaagtcgaccctgcctttcta
gtcgcactccaacaagcaaaagcaaatatcgaaagtttccacagcaagcaaaaacaacat
gcttttcttgatagcgaaaaagatggcgtcattcgcggtcaattaattcgtccactagaa
accgtcggcatatacgttcccggtggcacggcagcctatccatcatcggtattaatgaat
gtgttgcctgccaaaattgctggagtaaagcgaatcgtaatgatcacccctcctgccgaa
aacggtattaatcctcacgttttagccgcggctcaactagctggtgtggacgaaatttac
caagttggtggtgcgcatggaatcgcagctcttgctcacggaacagaatccatccctaaa
gtagataaaatcgtcggtcctggaaatatctatgtcgccactgccaaacgtgaagtgttt
ggcttagttgatatcgacatgatagctggtccatccgaaatcgtcgtgctcgcagatgaa
aatgccaatcccgctttcattgcttccgacttactctcccaagcagagcatgatatttta
gctcgtgctatcttaatcactactagtaaaaaaatcgccgaggaaactcagaacgaaatt
aataaacagctagaaaatttacctcgaaaagcgattgctcagaaatccatcgaaacacaa
gggaaaatcattatcgcagcaaatacgcaagaaatgtttgatattatgaacgaaatcgct
cctgaacacttagaagtacaacttgaaaatccaatgaattacctcaatcaaattaaaaat
gccggttcgattttcttaggaagctatgcatcggaacctcttggcgactattttgccgga
ccaaatcacgtcttacctacaagtggtaccgcgaaattcttctctcctctcggcgtggaa
gatttcacgaaacgttctgcctttatttcttacacaaaagaagcactcgcaaaagaaaaa
gacgctattgttttacttgctaaaaaagaaggcctagatgcccatgccaaagccattcaa
attcgtttcgaggaggaaaactaa

DBGET integrated database retrieval system