KEGG   Listeria monocytogenes SLCC5850: LMOSLCC5850_0885Help
Entry
LMOSLCC5850_0885  CDS       T02223                                 

Gene name
hemG
Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
lmoc  Listeria monocytogenes SLCC5850
Pathway
lmoc00860  Porphyrin and chlorophyll metabolism
lmoc01100  Metabolic pathways
lmoc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lmoc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    LMOSLCC5850_0885 (hemG)
Enzymes [BR:lmoc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     LMOSLCC5850_0885 (hemG)
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     LMOSLCC5850_0885 (hemG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Pyr_redox_3 Pyr_redox_2 FAD_binding_2 Thi4 HI0933_like Pyr_redox GIDA FAD_oxidored Trp_halogenase
Motif
Other DBs
NCBI-ProteinID: CBY51354
Position
903716..905095
Genome map
AA seq 459 aa AA seqDB search
MKHIVIIGGGLSGLAAAYELQKTHPNYTWELVEKDEKLGGKFETVKRDGFLIEKGPDSFL
ARKPAGVGLVKDLGLEDKLIANATGRSYIYHQKALHPIPEGSVMGIPTDKEALLASTLVS
EIGKARALQEPTMERNNQERDQALGDFFEARFGKELVKTIIEPLLSGIYAGDIYKMSLRA
TFPQFEQTVKKYGNLMDGLKESSMQTTGTKATIGAFRTLEGGLDALPKAIAAALPKENLH
TAKQATEIVKKNNAYEISFADGDKMEADGIIIAATHDALIHLLAETTTEPFAGQPLTTLA
TVSLAYNEQDVPILPDGTGYLVARTAPYKTTACTWVQKKWPHMVPKNKMLLRGFVGKAGE
TWLEQASDEAIVSAVLRDYAEIMDLHAAPLFYEVSRMKSAMPQYLVNHQDRLKQLKKNIK
TDYPGVYLAGMSYEGVGIPDCIAGAQTAAKELVDYLEEV
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacatatagtcattatcggaggcggcttatcagggctcgcagcagcgtatgaacta
caaaaaacacatccgaattatacgtgggaattagtagaaaaagacgaaaaactaggcggg
aaatttgaaacggttaaacgtgacgggtttttaattgaaaaaggtccagattccttctta
gctagaaaacctgctggtgtgggcttagtaaaagatttaggactcgaagataaactgatt
gcgaacgcgacaggaagatcttacatttaccaccaaaaagcgcttcatccgattccagaa
ggctctgtgatgggaattccgacagataaagaagcactgctagctagtacacttgtatcc
gaaattgggaaagctcgcgcacttcaagaaccaacaatggaacgaaataatcaagaacga
gatcaagcacttggcgatttctttgaagcgcgattcggtaaagaattagtcaaaacaatt
atcgaaccacttttatcaggaatttatgccggggatatatacaaaatgagtttacgcgcc
acttttccacaattcgaacaaacagttaaaaaatatgggaatttgatggatggtttaaaa
gaaagtagcatgcaaacgacagggacaaaagccactattggtgcttttagaacattagaa
ggtgggctagatgctttgccaaaagctattgccgccgcacttccaaaagaaaatttgcat
acagcaaaacaagcaacagaaattgtgaagaaaaataacgcttacgaaatttcttttgca
gatggcgataaaatggaggcagatggcatcattatcgctgccacacatgatgcgttaatt
catttattagcagaaacaacgacagaaccattcgcgggacaaccgcttacgacccttgcg
accgtttcgttagcatataatgaacaagacgtaccgattttacctgatggaacaggctat
ctagttgccagaaccgcaccatataaaaccactgcttgtacatgggtgcagaaaaaatgg
ccgcatatggtaccaaagaacaaaatgttactacgaggctttgttgggaaagcaggagaa
acttggttagagcaagcaagcgatgaagcaatcgtctcagctgttttgagagattatgcg
gaaattatggaccttcacgccgcgccacttttttatgaagtaagccgaatgaaatccgcg
atgcctcaatacttagttaatcaccaggaccgactaaaacaattgaaaaagaacatcaaa
acagattacccaggtgtttatcttgcaggaatgagctacgaaggtgtgggtattcctgat
tgcatcgcaggggctcaaacagccgctaaggaattagtagattacttggaagaggtgtaa

DBGET integrated database retrieval system