KEGG   Listeria monocytogenes SLCC5850: LMOSLCC5850_0920Help
Entry
LMOSLCC5850_0920  CDS       T02223                                 

Gene name
bglH
Definition
beta-glucosidase (EC:3.2.1.21)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lmoc  Listeria monocytogenes SLCC5850
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:lmoc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMOSLCC5850_0920 (bglH)
Enzymes [BR:lmoc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     LMOSLCC5850_0920 (bglH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
933640..935091
Genome map
AA seq 483 aa AA seqDB search
MFENYQFPKDFLWGGAIAANQAEGAFKVDGKGISLADLHKYHKGKTNDEISEEQHKGVSL
ADIKASMEDKVNYYPKRHGIDFYHTYPEDLALLAEMGFKTFRTSLDWTRIFPTGEETKPN
EAGLKYYDQLIDKIIELGMEPIITILHYETPVEIVLNHGGWHNRKVIDLFEKYGKTVLDR
YNKKVKYWIVINQINLIQFEPFNSTAIPYDAVDDYLSATYQAVHNQFVASAKIYEYGKAL
NPDLMIGTMLADCTAYPFSCDPDDIVLAMKRNRMEYFFADVQFQGEYPQYALNYFEENNI
HIEITEEDKAILQKNTMDYLALSYYYSQMVDSKRNDLDPASIAPNPHLKANPWGWAVDPK
GLYNALSQYWDRYHKPIIIAENGFGMYDKLENGEIHDDYRIDYLSAHLKEMKRAMYDGVE
IIAYCAWGPIDIVSCSSAQMEKRYGFIYVDLDNEGNGTGKRIKKDSFSWYKKVIESNGED
LEA
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaaaattatcaatttccgaaagactttttatggggaggagctatcgcagccaac
caagcagaaggcgcatttaaagtagatggaaaaggaattagtttagcagatttgcacaaa
tatcataaaggtaaaacaaatgatgaaatcagtgaggaacaacataaaggagtaagtttg
gctgatatcaaagcaagtatggaagataaagtgaactattatccgaaacgccacggtatc
gacttttatcacacgtatccagaagacttggctttgcttgctgaaatgggttttaaaaca
ttccgaacttcactggactggacacggatttttccaactggcgaagaaacgaaaccaaat
gaagcgggattaaaatattatgaccaattaatcgataaaattatcgaacttggcatggag
ccaattattacgattttacattacgaaactcccgtagaaattgttttaaatcatggcggg
tggcacaatcgtaaagtcattgatttatttgagaagtacggcaaaacagtacttgatcgc
tacaataaaaaagtaaaatattggattgtcattaaccaaattaatttaattcaattcgaa
ccatttaactctactgcgattccatacgatgcagttgatgattatttatccgcaacatat
caagcagttcacaatcaatttgtcgcaagtgcaaaaatttatgaatacggaaaggcactg
aaccctgatttaatgattggtacaatgctagctgattgtacggcctatccattctcatgc
gatccggatgatatcgtcctcgcaatgaaacgtaatcgtatggaatatttcttcgcagat
gtgcagttccaaggcgaatatccacaatatgcgcttaactacttcgaagaaaataatatt
catattgaaattacagaagaagacaaagctattttgcaaaaaaataccatggattatcta
gcgctttcctattattattcacaaatggtagattccaaaagaaatgatttggacccagct
tcgattgcaccaaacccgcatcttaaagctaatccgtggggctgggcagtcgatccaaaa
gggctatataatgctctgtcacaatactgggatagataccataaaccaattattattgct
gaaaatggtttcggcatgtatgacaaattggaaaatggcgaaatccacgatgattaccga
atcgattatttatccgcccatctaaaagaaatgaaacgtgctatgtatgatggcgtagaa
ataatcgcatattgcgcttggggaccgattgatatcgtcagctgttcttccgcacaaatg
gaaaaaagatacggtttcatttacgttgatttagataacgaaggaaacggcacaggcaaa
agaattaaaaaagacagcttttcatggtataaaaaagtaatagagtctaatggggaagac
ttagaagcttaa

DBGET integrated database retrieval system