KEGG   Listeria monocytogenes SLCC5850: LMOSLCC5850_1618Help
Entry
LMOSLCC5850_1618  CDS       T02223                                 

Gene name
hemB
Definition
(GenBank) porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
lmoc  Listeria monocytogenes SLCC5850
Pathway
lmoc00860  Porphyrin and chlorophyll metabolism
lmoc01100  Metabolic pathways
lmoc01110  Biosynthesis of secondary metabolites
lmoc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lmoc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    LMOSLCC5850_1618 (hemB)
Enzymes [BR:lmoc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     LMOSLCC5850_1618 (hemB)
Exosome [BR:lmoc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LMOSLCC5850_1618 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD Metallophos_3
Motif
Other DBs
NCBI-ProteinID: CBY52087
Position
complement(1592485..1593459)
Genome map
AA seq 324 aa AA seqDB search
MKNQFDRHRRLRKTKTMRDLVRETVLHTDDLIYPIFVKDGKEPKTEVVSMPGVFQYPLHE
LEEEMRVVESLGIKAVILFGIPAEKDAVGTQAYHDHGIIQEATRLIKKSFPEILVVADTC
LCEFTDHGHCGVIENGEILNDESLELLKQTAVSQAAAGADIIAPSNMMDGFVQVIREGLD
EAGFYDIPIMSYAVKYASAFYGPFRDAAGSAPQFGDRKSYQMDPANREEALREAKSDEQE
GADFLIVKPSLSYLDIMRDVKNNTNLPVVAYNVSGEYAMVKAAAQNGWIDEEKIVIEMLT
SMKRAGATLIITYFAKDVSKYLNK
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatcaatttgatagacatcgtcgtctaagaaaaaccaaaacaatgcgtgattta
gtaagagaaacagttttacatacagatgatttaatctatccgatttttgttaaagatggc
aaagaaccaaaaacagaagtagtttctatgcctggggtttttcaatatcctttacatgaa
ttagaagaagaaatgcgcgtagttgaaagtcttggtattaaagcggttattttatttggc
attcctgccgaaaaagacgcagttggtacgcaagcttatcacgaccacggaattattcaa
gaagctacaagacttattaaaaaaagttttcctgaaattcttgtggtggctgacacttgt
ttatgtgaatttactgatcatggacattgtggtgttattgaaaacggtgaaattctcaat
gacgaatcgcttgaattattgaaacaaacagctgtcagtcaagccgcagcaggagcggat
atcattgctccatctaatatgatggatggttttgttcaagtcattcgcgaagggttagat
gaagctgggttttatgatatcccaattatgtcttatgctgttaaatatgcttctgctttt
tacggaccgttccgtgatgctgctggcagtgcacctcaatttggtgataggaaatcttat
caaatggatcctgccaatcgtgaagaagctcttcgcgaagcaaagtcggatgaacaagaa
ggcgcagattttcttattgtaaaaccatcattatcttacttagatatcatgcgcgacgtt
aagaataataccaatttaccagtagttgcctacaatgttagtggtgaatatgcaatggta
aaagcagctgcgcaaaatggttggatagacgaagaaaaaattgttatagaaatgctaact
agtatgaaacgagcgggtgcaacacttatcattacttattttgcaaaagatgtatctaaa
tacttaaataaatag

DBGET integrated database retrieval system