KEGG   Listeria monocytogenes SLCC5850: LMOSLCC5850_1619Help
Entry
LMOSLCC5850_1619  CDS       T02223                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
lmoc  Listeria monocytogenes SLCC5850
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:lmoc00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1593456..1594178)
Genome map
AA seq 240 aa AA seqDB search
MSKKVVLTREASKNKPWQTYFSQNGYEVMSIPLIKTQPIKINLSREQQETDWLFLTSANA
VEYFFTNQYERSNYKIAVIGEKTKEKLAEFGHEPSFVPSIYQSEVFLEEWLNENPEKTSI
LLPQSNLSRTIIKDTLIEKGYIVFSIELYETIFPEASKKLLTEQLKLNETQIIVFASPSA
WKNFYSIAKSFPAQKEKWHIASIGSITTEAILADGWEVKYQPKTFTMKHLADLIIQEELK
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaaaagttgttttaacaagagaagcgagtaaaaacaaaccatggcaaacctat
ttttcacaaaatggttatgaggtgatgtccatcccgcttattaaaacacaacctataaaa
attaatttgagccgagaacaacaagaaacagactggctttttttaacaagtgctaatgct
gtagaatatttcttcacgaaccaatatgagagatccaattacaaaatagctgtcatcggc
gaaaaaacaaaagaaaagttggcagaatttggtcacgaaccaagttttgtcccatctatc
tatcagtcagaagtatttttagaagaatggttaaacgagaacccagagaaaacaagtatc
ttactaccacaaagtaatttaagcagaacaataataaaagatacattgatagaaaaaggt
tatatcgttttttcgattgagctctacgaaacaatttttccagaggcttctaaaaaactg
ttaaccgaacaactgaaactaaatgaaacacaaataattgtttttgccagcccatctgca
tggaaaaacttctattccatcgcgaaatcattccctgctcaaaaagagaagtggcatatc
gcatcaattggtagtattacaacagaggccattctagcagatggatgggaagtaaaatat
caaccaaaaaccttcaccatgaagcacctagctgatttgataatacaggaggaattaaaa
tga

DBGET integrated database retrieval system