KEGG   Listeria monocytogenes SLCC5850: LMOSLCC5850_1692Help
Entry
LMOSLCC5850_1692  CDS       T02223                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
lmoc  Listeria monocytogenes SLCC5850
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lmoc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LMOSLCC5850_1692 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LMOSLCC5850_1692 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LMOSLCC5850_1692 (trpA)
Enzymes [BR:lmoc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LMOSLCC5850_1692 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1672059..1672832)
Genome map
AA seq 257 aa AA seqDB search
MTKTLTNKLAEKEHAAVVTYIMGGDGGLDNLEEQLLFLEKSGVSAIEIGIPFSDPVADGP
IIQLAGLRALKEQVSLEAILNKLAMSKVQIPLIIMSYINPIFHLGIPKFVELVQKTPVKG
LIIPDLPYEHQKLITPELQGTDIALIPLVSLTSPKERLEEIAKQAEGFIYAVTVNGTTGV
RSEFDAHIDSHLAYLKSISPVPVLAGFGVSSIEHVEKFAHVCDGVIIGSKVVQMLHEEKT
AELGAFLQKAAEVRIKN
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaacattaacgaataaactagcggaaaaagagcatgctgctgtcgttacttat
attatgggtggagatggtggtttagataatttagaagaacagttattgtttctagaaaaa
tctggcgtaagcgcgattgaaattggcattcctttttctgatccggttgctgacggacca
attattcaacttgctgggttacgtgctttaaaggagcaagtgagtttagaagccatttta
aataaattggctatgagtaaagtgcaaattccgctaattattatgagttatattaatccg
atttttcatttaggtattccaaaatttgttgaattggtgcagaaaacgccggtgaaaggg
cttattattccggatttaccttatgagcaccaaaaactgattacaccagaacttcagggg
acagatatcgcactcattccactcgtttcattgactagcccgaaagagcgccttgaagaa
attgcgaaacaggcagaaggatttatatatgcagtaacagttaacggaactactggtgtg
aggagtgaatttgatgcccatattgatagccatttagcttatttgaaaagcattagccct
gttccagttctcgcaggttttggtgtttcttctattgaacatgtagaaaaatttgcgcac
gtatgtgatggtgtgataatcggtagtaaagtcgtgcaaatgttgcatgaagaaaaaacg
gcagagctaggagcgtttttacaaaaggctgctgaagttcgaatcaaaaactaa

DBGET integrated database retrieval system