KEGG   Listeria monocytogenes SLCC5850: LMOSLCC5850_2459Help
Entry
LMOSLCC5850_2459  CDS       T02223                                 

Gene name
tpi
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lmoc  Listeria monocytogenes SLCC5850
Pathway
lmoc00010  Glycolysis / Gluconeogenesis
lmoc00051  Fructose and mannose metabolism
lmoc00562  Inositol phosphate metabolism
lmoc01100  Metabolic pathways
lmoc01110  Biosynthesis of secondary metabolites
lmoc01120  Microbial metabolism in diverse environments
lmoc01130  Biosynthesis of antibiotics
lmoc01200  Carbon metabolism
lmoc01230  Biosynthesis of amino acids
Module
lmoc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lmoc_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lmoc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMOSLCC5850_2459 (tpi)
   00051 Fructose and mannose metabolism
    LMOSLCC5850_2459 (tpi)
   00562 Inositol phosphate metabolism
    LMOSLCC5850_2459 (tpi)
Enzymes [BR:lmoc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LMOSLCC5850_2459 (tpi)
Exosome [BR:lmoc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LMOSLCC5850_2459 (tpi)
  Exosomal proteins of bladder cancer cells
   LMOSLCC5850_2459 (tpi)
  Exosomal proteins of melanoma cells
   LMOSLCC5850_2459 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CBY52928
Position
complement(2487644..2488399)
Genome map
AA seq 251 aa AA seqDB search
MRKPIIAGNWKMNKTAAKAGQFAEDVKNNVPSSDAVESVVAAPALFLQELVRLTEGTNLR
VSAQNCYFEDEGAFTGEISPFALADLGVSYVIIGHSERREYFHETDEDINKKAHAIFKHG
MTPIICCGETLDQREAGQTDTWVRGQIRAALAGLTEEQVIKSVIAYEPIWAIGTGKSSTS
ADANETCAVIRAEVADAVSQKAADAVRIQYGGSVKPENIADYLAESDIDGALVGGASLEP
ASFLALLEAVK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaccaattattgctggtaactggaaaatgaacaaaactgctgcaaaagcagga
caatttgcagaagacgtaaaaaataacgtgccatcaagcgatgctgttgaatcagtagtt
gctgcaccggctctatttttacaagaattagttcgtcttactgaaggaactaatcttcgt
gtatctgcacaaaactgttattttgaagacgaaggtgctttcactggcgaaattagcccg
tttgcacttgctgacttaggcgtttcttatgttattatcggacactctgaacgtcgtgag
tacttccacgaaacagacgaagatattaacaaaaaagcacatgcaatcttcaaacacggc
atgacaccaatcatttgctgtggtgaaacattagatcaacgtgaagctggtcaaacagat
acttgggtacgtggtcaaatccgtgcagctcttgctggattaacggaagaacaagtaatc
aaatctgttattgcttatgaaccaatttgggcaatcggtactgggaaatcttctacaagt
gctgatgcaaacgaaacttgtgcagttattcgtgcagaagttgctgacgctgtatctcaa
aaagcagcagacgcagttcgtattcaatacggcggtagcgtaaaacctgaaaacattgct
gattatcttgcagagtccgacattgacggcgctcttgtaggtggagcaagcttagaacca
gcatcgttcttagcattattggaggcagtaaaataa

DBGET integrated database retrieval system