KEGG   Listeria monocytogenes SLCC5850: LMOSLCC5850_2784Help
Entry
LMOSLCC5850_2784  CDS       T02223                                 

Gene name
bglA
Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lmoc  Listeria monocytogenes SLCC5850
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lmoc00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2819440..2820888)
Genome map
AA seq 482 aa AA seqDB search
MSNTKFPDGFMWGGATAANQFEGGYNLGGKGLACADLFTGGTHTEPRRITAQLEESTFYP
SHEAVDFYHHYKEDIKLMAEAGFKVFRMSINWTRIFPTGKEAEPNEEGLQFYEDVFNELK
KHQIEPLVTIAHFDIPLALTNEVNGWASRDLIDYYLHFCEVIFKRYKHLVKHWLTFNEIN
TATMEIGNYLSLGIRHAEGDFLHQKDDPKVRYQALHHQFVASAKAVKLGHSINPDFMIGC
MIAYMPRYPRTCEPSDVLLAKQTEAMHSHFCGDVHVKGYYPFYAKTFFKDNGIELEFDPE
DEQILREGTVDFYTFSYYLTLCASNDPAYKNSGKSVIGGAENPYLKTNDWGMQTDPVGLR
IALNDLYTRYNIPLMVVENGLGAFDKLEDDGTINDPYRIDYFKEHILQMHKAIQDGVDLI
GFTIWGCIDLVSASTGEMAKRYGIIYVDKYDDGTGDYSRKKKASYYWYKDVISSNGEIGL
EE
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatacgaagtttccagatggctttatgtggggcggggcgaccgcggctaaccag
tttgaaggcggttataatttaggcggaaaaggacttgcctgtgcggatttattcactggt
ggaacgcatacagagccaagaagaattaccgcacaattagaagaatccactttttatcca
agtcatgaagcagtggacttttatcaccattataaagaggatattaagttaatggcagaa
gctggatttaaagtgttccggatgtcaataaactggactcgtattttcccgacaggaaag
gaagcagagcctaacgaggaaggattgcagttttatgaagatgtttttaatgagctgaaa
aaacatcagattgaaccgttagtgacgattgctcattttgatattccgctagcattaaca
aatgaggtgaacggctgggcatcacgagatttgattgattactatcttcatttttgtgaa
gtgatttttaaacgttataaacatttagtaaaacactggttgactttcaatgaaataaat
actgcaacaatggaaattgggaattatttatcgcttgggattcgtcatgcggagggggat
tttcttcatcaaaaagatgacccaaaagtgagatatcaagcgcttcatcatcaatttgtt
gctagcgcaaaagcggtaaaactaggacatagcatcaacccagacttcatgattggctgc
atgattgcttatatgccacgctacccgcgtacttgcgaaccatccgatgttttgctagct
aagcagacggaagcaatgcacagccatttctgcggcgacgttcatgtcaaaggttattat
cctttttatgcaaaaacgttttttaaagataatggcattgagcttgaatttgatccagaa
gatgaacaaattttgcgagaaggcacggttgatttttacacatttagctattatctaacg
ctttgtgcatccaacgatcctgcctataaaaattcgggaaaaagtgttatcggaggggct
gaaaatccttatttaaaaacaaatgattggggaatgcagacagatcctgtagggcttcgg
attgcgctgaatgacttatatactcgctataatattccgcttatggtagttgaaaatggt
ttaggagcctttgataaattggaagatgatgggacgattaatgatccgtatcgaattgat
tatttcaaagagcatattcttcaaatgcataaagcgattcaagatggtgttgatttgatt
ggctttactatttggggttgtattgacttagtgagcgcatctacaggggaaatggccaag
cgttatggcattatttatgtggataaatacgatgatggaaccggcgattattcgcgtaaa
aagaaagcatcctattattggtataaagatgtgattagttcaaatggtgaaattggattg
gaagagtaa

DBGET integrated database retrieval system