KEGG   Listeria monocytogenes EGD: LMON_0889Help
Entry
LMON_0889         CDS       T02872                                 

Definition
Protoporphyrinogen IX oxidase, aerobic, HemY (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
lmod  Listeria monocytogenes EGD
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lmod00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    LMON_0889
Enzymes [BR:lmod01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     LMON_0889
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
904197..905576
Genome map
AA seq 459 aa AA seqDB search
MKHIVIIGGGLSGLAAAYELQKTHPNYTWELVEKDEKLGGKFETVKRDGFLIEKGPDSFL
ARKPAGVGLVKDLGLEDKLIANATGRSYIYHQKALHPIPEGSVMGIPTDKEALLASTLVS
EIGKARALQEPTMERNNQERDQALGDFFEARFGKELVKTIIEPLLSGIYAGDIYKMSLRA
TFPQFEQTVKKYGNLMDGLKESSMQTTGTKATIGAFRTLEGGLDALPKAIAAALPKENLH
TAKQATEIVKKNNAYEISFADGDKMEADGIIIAATHDALIHLLAETTTEPFAGQPLTTLA
TVSLAYNEQDVPILPDGTGYLVARTAPYKTTACTWVQKKWPHMVPKNKMLLRGFVGKAGE
TWLEQASDEAIVSAVLRDYAEIMDLHAAPLFYEVSRMKSAMPQYLVNHQDRLKQLKKNIK
TDYPGVYLAGMSYEGVGIPDCIAGAQTAAKELVDYLEEV
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacatatagtcattatcggaggcggcttatcagggctcgcagcagcgtatgaacta
caaaaaacacatccgaattatacgtgggaattagtagaaaaagacgaaaaactaggcggg
aaatttgaaacggttaaacgtgacgggtttttaattgaaaaaggtccagattccttctta
gctagaaaacctgctggtgtgggcttagtaaaagatttaggactcgaagataaactgatt
gcgaacgcgacaggaagatcttacatttaccaccaaaaagcgcttcatccgattccagaa
ggctctgtgatgggaattccgacagataaagaagcactgctagctagtacacttgtatcc
gaaattgggaaagctcgcgcacttcaagaaccaacaatggaacgaaataatcaagaacga
gatcaagcacttggcgatttctttgaagcgcgattcggtaaagaattagtcaaaacaatt
atcgaaccacttttatcaggaatttatgccggggatatatacaaaatgagtttacgcgcc
acttttccacaattcgaacaaacagttaaaaaatatgggaatttgatggatggtttaaaa
gaaagtagcatgcaaacgacagggacaaaagccactattggtgcttttagaacattagaa
ggtgggctagatgctttgccaaaagctattgccgccgcacttccaaaagaaaatttgcat
acagcaaaacaagcaacagaaattgtgaagaaaaataacgcttacgaaatttcttttgca
gatggcgataaaatggaggcagatggcatcattatcgctgccacacatgatgcgttaatt
catttattagcagaaacaacgacagaaccattcgcgggacaaccgcttacgacccttgcg
accgtttcgttagcatataatgaacaagacgtaccgattttacctgatggaacaggctat
ctagttgccagaaccgcaccatataaaaccactgcttgtacatgggtgcagaaaaaatgg
ccgcatatggtaccaaagaacaaaatgttactacgaggctttgttgggaaagcaggagaa
acttggttagagcaagcaagcgatgaagcaatcgtctcagctgttttgagagattatgcg
gaaattatggaccttcacgccgcgccacttttttatgaagtaagccgaatgaaatccgcg
atgcctcaatacttagttaatcaccaggaccgactaaaacaattgaaaaagaacatcaaa
acagattacccaggtgtttatcttgcaggaatgagctacgaaggtgtgggtattcctgat
tgcatcgcaggggctcaaacagccgctaaggaattagtagattacttggaagaggtgtaa

DBGET integrated database retrieval system