KEGG   Listeria monocytogenes EGD: LMON_2305Help
Entry
LMON_2305         CDS       T02872                                 

Definition
Multimodular transpeptidase-transglycosylase (EC:2.4.1.129)
Orthology
K12555  
penicillin-binding protein 2A [EC:2.4.1.129 2.3.2.-]
Organism
lmod  Listeria monocytogenes EGD
Pathway
beta-Lactam resistance
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:lmod00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LMON_2305
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    LMON_2305
Enzymes [BR:lmod01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     LMON_2305
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     LMON_2305
Glycosyltransferases [BR:lmod01003]
 Polysaccharide
  Bacterial polysaccharide
   LMON_2305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2319820..2321964)
Genome map
AA seq 714 aa AA seqDB search
MDKFKQQLIKYLKLFFGFIGKWLNKGWQKFRRFWKNKHIGKIFLLAGLVFLLSFIIYLVI
VAKSADIDALKKGLESATIIYDKDGDKAGELSSTDATFVSIDKISKNLQNAVVSIEDRKF
YEHKGFDLKGIARAGVNLVTSGGISGGGSTITQQLAKNALLTQEQTFTRKAKEIFMAREI
EKTYSKDEIMEMYLNRSYFGNGEWGVENASLKYFGKSAADLNIPEAATIAGLLQAPSAYD
PYQHIDKATNRRNMVLNAMVETGTISKAEGDKYKATKIVLNDQSKDPLANKYPWYVDAVI
NEAVNEADITQDEIMQKGYKIYTELDQNYQTSLENVYNNDGLFPSNANDGTLVQSGAVLM
DPATGGIRALVGGRGEHVFRGFNRATQMKAQPGSTMKPLAVYTPALQSGYDVDSMLKDEK
ITYKGNYTPTNVGGVYSGEVPMYKAVANSINAPAVWLLDQIGIDKGVKSVEKFGITVPEK
DRTLGLALGGMSKGASPVEMATAYATFANNGAKPESHIITKIVDPSGNTVYENVPKTKQI
ISETVSNEMTSMLLDVINTGTGQSAAVSGHEMAGKTGSTQVPFDDTSGTKDQWFVGYTPN
LVGAVWMGYDKTDKEHYLTTTSSAGVSSLAHYVMNSGLQYQKSADFSTKSAAQETAAKKE
EEEKEKNSGSDFWSGVKEKADEAGETIKKGADKVKEFGGKVSDGIGNLIDSIGN
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atggacaaattcaaacagcaacttattaaatacttaaaattattctttggttttataggg
aaatggcttaacaaaggatggcaaaaatttagacgcttctggaaaaacaaacatatcgga
aagatttttttactagctggacttgtatttttattaagttttattatttatcttgtaata
gtagcaaagtctgccgacatagacgcgcttaaaaaaggtttagagtcagccacaattatt
tatgacaaagatggcgacaaggccggggaactttcttctactgacgcaacatttgtatcc
atcgataaaatatctaaaaacttacaaaatgcagtagtttccattgaagatagaaaattt
tatgaacataaaggttttgacttgaaaggaatagctcgggctggtgttaatttagtcact
agcggaggaatttctggtggcggtagtacgattacgcagcaactcgccaaaaatgctctg
ctgacacaagaacaaaccttcacacgaaaagccaaagaaatatttatggctcgtgaaatc
gaaaaaacctactcaaaagacgaaattatggaaatgtacttaaaccgttcttactttggt
aatggggagtggggagtagaaaatgcctccttaaaatattttggtaaatcagcagcagac
ttaaacataccagaagctgcgacaattgctggattgcttcaagctccaagtgcgtatgac
ccttaccaacatatcgacaaagcgactaatcgccgcaacatggtattaaatgcaatggtc
gaaacaggcacaatttcaaaagcagaaggcgataaatacaaagctacaaaaatagtttta
aatgatcaatcaaaagatccgcttgcgaataaatacccatggtacgttgatgcagttatt
aatgaggctgtaaatgaagcagatataacgcaagatgaaatcatgcaaaaaggatataaa
atctatacggaattagatcaaaattatcaaacttccttagaaaatgtttacaacaatgat
gggctattcccttctaatgcaaatgatggcacattagttcaatcaggagctgttttaatg
gacccagctactggtggaattagagcgcttgttggtggacgcggagagcatgttttccgt
ggctttaacagagcgacacagatgaaagcacaaccaggctccacgatgaagccactcgcg
gtatacacaccagcgcttcaatcaggttatgacgtggattcaatgctaaaagatgaaaaa
ataacctacaaaggtaactatacaccaaccaatgttggcggcgtttatagtggagaagtt
ccaatgtataaagctgtagccaactcgattaatgcccctgccgtttggttacttgatcaa
attggtatcgataaaggcgtaaaatctgtcgaaaaatttggtattacagttccagaaaaa
gatagaacgctcgggcttgcactcggtggtatgagtaaaggtgcttcgccagtagaaatg
gcaacagcgtatgcaacctttgctaacaacggtgccaaaccagaatctcatattattact
aaaattgtcgatccatcagggaatacagtatatgaaaatgttccaaaaactaaacaaatc
atttcagaaacagtatctaatgaaatgacttccatgcttttagatgttatcaatacaggg
actggtcaaagtgcagctgtttccggtcacgaaatggctggaaaaactggttccacgcaa
gttccatttgatgatacaagcggtacaaaagatcaatggtttgtaggctacacaccaaac
ctagtcggagccgtttggatgggatatgataaaactgacaaagagcattatctaactaca
accagttctgctggtgtttctagtttggctcactacgtaatgaatagtggtttgcagtat
cagaaatccgcagactttagtacgaagagtgccgcacaagaaactgcagcgaaaaaagaa
gaggaagaaaaagaaaagaacagtggtagcgacttttggagtggcgtgaaagaaaaagcc
gatgaagctggagaaacaatcaaaaaaggcgccgataaagtaaaagaattcggtggaaaa
gtttctgatggtattggaaacttaatcgattcgataggtaattaa

DBGET integrated database retrieval system