KEGG   Listeria monocytogenes La111: BN418_1069Help
Entry
BN418_1069        CDS       T02512                                 

Definition
Protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
lmoe  Listeria monocytogenes La111
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lmoe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BN418_1069
Enzymes [BR:lmoe01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     BN418_1069
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
854239..854820
Genome map
AA seq 193 aa AA seqDB search
MRPEDHLSSKSASSDSRRLCDGNSDRQRGTASKARALQEPTMERNNQEQDQALGDFFEAR
FGKELVKTIIEPLLSGIYAGDIYKMSLRATFPQFEQTVKKYGNLMDGLKESSMQTTFSNI
RRRARCFPKAIAAALPKENLHTAKQATYEISFADGDKMEADGVIIAATHDALIHLLAEKT
TEPFAGQPLTTLA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgcgaccggaagatcatttatcatcaaaaagcgcttcatccgattccagaaggctctgt
gatgggaattccgacagacaaagaggcactgctagcaaagcacgagcacttcaagaacca
acaatggaacggaataatcaagaacaagatcaagcacttggcgatttctttgaagcgcga
ttcggtaaggaattagtcaaaacaattatcgaaccacttttatcaggaatttatgccggg
gatatatacaaaatgagtttacgcgccacttttccacaatttgaacaaacggttaaaaaa
tatggaaatttgatggatggtttgaaagaaagcagcatgcaaacgaccttttcgaacatt
agaaggcgggctagatgctttccaaaagccattgcggccgcacttccaaaagaaaacttg
catacagcaaaacaagcaacttacgaaatctcgtttgcagatggcgataaaatggaagca
gatggcgtcattattgctgccacacatgatgcgttaattcatttgttagctgaaaaaacg
acagaaccattcgcgggacaaccgcttacgactcttgcttag

DBGET integrated database retrieval system