KEGG   Listeria monocytogenes La111: BN418_1925Help
Entry
BN418_1925        CDS       T02512                                 

Definition
(GenBank) Acetaldehyde dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
lmoe  Listeria monocytogenes La111
Pathway
lmoe00010  Glycolysis / Gluconeogenesis
lmoe00071  Fatty acid degradation
lmoe00350  Tyrosine metabolism
lmoe00620  Pyruvate metabolism
lmoe00625  Chloroalkane and chloroalkene degradation
lmoe00626  Naphthalene degradation
lmoe00650  Butanoate metabolism
lmoe01100  Metabolic pathways
lmoe01110  Biosynthesis of secondary metabolites
lmoe01120  Microbial metabolism in diverse environments
lmoe01130  Biosynthesis of antibiotics
lmoe01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lmoe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN418_1925
   00620 Pyruvate metabolism
    BN418_1925
   00650 Butanoate metabolism
    BN418_1925
  Lipid metabolism
   00071 Fatty acid degradation
    BN418_1925
  Amino acid metabolism
   00350 Tyrosine metabolism
    BN418_1925
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BN418_1925
   00626 Naphthalene degradation
    BN418_1925
Enzymes [BR:lmoe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BN418_1925
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     BN418_1925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: CCQ21109
UniProt: A0A1C7PU24
Position
1568396..1570996
Genome map
AA seq 866 aa AA seqDB search
MAIKENAAQEVLEVQKVIDRLADNGQKALKAFESYNQEQVDNIVHAMALAGLDQHMPLAK
LAVEETGRGLYEDKCIKNIFATEYIWNNIKNNKTVGVINEDLQTGVIEIAEPVGVVAGVT
PVTNPTSTTLFKAIIAIKTRNPIIFAFHPSAQRCSSAAAKVVYDAAIAAGAPEHCIQWVE
KPSLEATKQLMNHDKVALVLATGGAGMVKSAYSTGKPALGVGPGNVPAYIDKTAKIKRSV
NDIILSKSFDQGMICASEQAVIVDKEVAKEVKAEMEANNCYFVKGAEFKKLESYVINPEK
GTLNPDVVGKSPAWIANQAGFKVPEDTKILVAEIKGVGDKYPLSHEKLSPVLAFIEAANQ
AEAFDRCEEMLVYGGLGHSAVIHSTDKEVQKAFGIRMKACRIIVNAPSAQGGIGDIYNGF
IPSLTLGCGSYGKNSVSQNVSATNLLNVKRIADRRNNMQWFKLPPKIFFEKYSTQYLQKM
EGVERVFIVTDPGMVQFKYVDVVIEHLKKRGNDVSYQVFADVEPDPSDVTVYKGAELMKD
FKPDTIIALGGGSAMDAAKGMWLFYEHPEASFFGLKQKFLDIRKRTFKYPKLGGKAKFVA
IPTTSGTGSEVTPFAVITDKENNIKYPLADYELTPDVAIVDAQYVTTVPAHITADTGMDV
LTHAIESYVSVMASDYTRGLSIRAIELVFENLRESVLTGDPDAREKMHNASALAGMAFAN
AFLGINHSLAHKIGPEFHIPHGRANAILMPHVIRYNALKPKKHALFPRYESFRADEDYAR
ISRIIGFPAATTEEGVKSLVDEIIKLGKDVGIDMSLKGQNVAKKDLDAVVDTLADRAFMD
QCTTANPKQPLVSELKEIYLEAYKGV
NT seq 2601 nt NT seq  +upstreamnt  +downstreamnt
atggcaattaaagaaaatgcggcccaagaagtattagaagttcaaaaagtgattgacaga
ttagcagacaatggacaaaaagcattgaaagcatttgaaagttacaaccaagaacaagta
gacaatatcgttcacgcaatggcacttgccggacttgaccaacatatgccccttgcaaaa
ttagcagtagaagaaactggacgtggattatacgaagataaatgtattaaaaacatcttc
gcgacagaatatatttggaacaacattaaaaacaataaaacagtcggagttattaacgaa
gacttacaaactggtgtgattgaaattgctgaaccagttggcgttgttgccggcgttaca
cctgtaactaacccaacatctactactcttttcaaagcaattatcgcgattaaaacgcgt
aacccaatcatctttgctttccatccaagtgcacaacgttgttcatcagcagcagcgaaa
gttgtatatgatgcagcaattgcagctggagctccagaacattgtattcaatgggtagaa
aaaccttccctagaagcaacaaaacaattaatgaaccatgataaagttgcacttgtactt
gcaactggtggtgctggaatggttaaatcagcatactctactggtaaacctgcactaggt
gttggaccaggtaacgtaccagcttacattgacaaaacagctaaaatcaaacgttctgtt
aatgacatcattctttctaaatcttttgaccaaggtatgatttgtgcttctgaacaagca
gtaatcgtagacaaagaagtggctaaagaagtaaaagcagaaatggaagcaaacaactgc
tacttcgttaaaggcgctgaattcaaaaaattagaaagctatgttatcaaccctgaaaaa
ggaacacttaacccagatgtagttggtaaatcccctgcatggattgcaaaccaagctggc
ttcaaagttccagaagatacaaaaattcttgtagctgaaattaaaggtgttggcgacaaa
tacccactatctcatgaaaaattaagcccagttcttgcatttatcgaagctgctaaccaa
gcagaagcattcgatcgttgtgaagaaatgttagtatatggaggacttggacactccgca
gttattcactctactgataaagaagttcaaaaagcatttggtatccgtatgaaagcttgc
cgtatcattgtaaacgcaccaagcgcacaaggcggtatcggtgacatttataacggcttc
atcccttccctaacacttggttgtggatcttatggtaaaaactctgtatcacaaaatgta
agtgcgactaacttgctgaacgttaaacgtatcgcggatcggagaaataatatgcaatgg
ttcaaacttccaccaaaaattttctttgaaaaatattccactcaataccttcaaaaaatg
gaaggcgttgaacgcgtatttatcgtaactgacccaggaatggttcaattcaaatatgtt
gatgttgtaatcgaacacttgaaaaaacgtggcaatgacgtatcttaccaagtatttgct
gacgttgaaccagatccatctgacgtaacagtttataaaggtgcagaactaatgaaagac
ttcaaaccggacacaattatcgctcttggtggtggttccgcaatggatgctgccaaaggt
atgtggttattctatgaacacccagaagcttcattcttcggcttgaaacaaaaattctta
gatattcgtaaacgtactttcaaatatcctaaacttggtggaaaagcaaaattcgtcgca
attccaacaacaagtggtacaggttctgaagtaacaccttttgcggttattacagacaaa
gaaaataacattaaataccctcttgctgactacgaattaactccagacgttgcgattgtc
gatgcacaatatgtaactactgttccagcacacattactgctgatactggtatggacgtt
ttaactcacgcaattgaatcttatgtatccgtaatggcaagcgattatactcgtggatta
tctatccgcgcaatcgaacttgtttttgaaaacttacgtgaatctgttcttactggtgat
ccagatgcgcgcgaaaaaatgcataatgcttctgccctagctggtatggcgtttgcaaat
gcgttcctaggaatcaaccacagcttggcacacaaaattggacctgaattccacattcct
cacggtcgtgcgaatgcaatccttatgccacatgttattcgttataacgcacttaaacct
aaaaaacatgcgttattcccaagatatgaaagtttccgtgctgatgaagattatgctcgt
atctctcgtattatcggcttccctgctgcaactacagaagaaggcgttaaatcacttgta
gatgaaatcatcaaacttggtaaagatgttggtatcgacatgagtcttaaaggacaaaat
gttgctaaaaaagatttggatgctgttgtagatactcttgcagatcgcgcattcatggac
caatgtactacagccaaccctaaacaacctcttgtaagtgaactaaaagaaatctacctt
gaagcttacaaaggtgtttga

DBGET integrated database retrieval system