KEGG   Listeria monocytogenes La111: BN418_3236Help
Entry
BN418_3236        CDS       T02512                                 

Definition
Putative sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
lmoe  Listeria monocytogenes La111
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:lmoe00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2649578..2651260
Genome map
AA seq 560 aa AA seqDB search
MQTELVNQIEVKLRKIYQAAYQPAYLEKMLACAENYSNNTRGSIDTISEKNVYLIAYGDS
IFEKNKHPLQTLNEFLQEYAQDVITDVHLLPIFPSTSDDGFSVTDYKQIDEQLGDWDDVQ
KMSENFRVMLDFVANHMSKSSDWFKRFSDNEAPYNQFFIEKDSQFDYKNVTRPRTSPLFH
KYENGKELWTTFSEDQLDLNVRNIDCLVALTDVLLFYASKQATSIRLDAIGFLWKTSGTT
CMHLPETHEIISLWRLLIDELYPNLQIITETNVPHEENISYFGDGENEANMVYQFPLPPL
VLHTFTCHDTTKLSKWAKSISQVSDTATYFNFLASHDGIGMRPATGILSDEEINSLVQKA
VQNGGQVSYKDNADGTQSVYELNINYGEALQNLDEDTTEELVTKKIIAAHSILLTLQGVP
AIYYHSLLGSKNDLVGYEESGINRRINREKLEKNQLVHELKTDTYRKTIFTSLKKLVQIR
RNHTAFSPFATQEILDLGPDVFAIKRESEGECIYGIINVTSHDISKKVAFSGTNLLANQP
VTSELELTAYEVVWIKKAVQ
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccgaactggttaatcaaatagaagtaaaactaagaaaaatttatcaagccgca
taccaacccgcatacttggaaaaaatgctcgcatgcgctgaaaactattctaataatacg
cgtggttcgattgatactatttccgaaaaaaacgtctatcttattgcttatggtgacagc
attttcgaaaaaaacaagcatccgttacaaacattaaatgagttcctacaagaatatgca
caagatgttattacagacgtccacttactaccgattttccctagtacgtcagatgatggc
ttctctgtcacagactacaagcaaattgacgaacagcttggcgactgggatgacgttcaa
aaaatgtctgagaacttccgagtgatgcttgatttcgtagccaatcatatgtcgaaatca
agtgattggttcaagcgattctccgataatgaagcgccgtacaatcaatttttcattgag
aaagacagccaatttgattataaaaatgttactcgcccgcggacttctccgctgttccac
aaatacgaaaacggcaaggaactttggactacttttagcgaagaccagttagacttaaat
gtccgtaatatcgattgccttgtagccttaacagatgtcctgcttttctatgcatccaaa
caagcgacaagcattcgtcttgatgctattggatttttatggaaaacatctggcacgact
tgtatgcacctaccagaaacgcatgagatcatttcgctttggcgtctgctgattgatgag
ctatatccgaatctgcaaattatcacagaaaccaacgtccctcatgaagaaaacattagt
tattttggcgatggcgaaaatgaagcaaatatggtttatcagttcccgcttccgccactt
gtgctccataccttcacttgccatgatacaacgaaactttcgaagtgggcgaaatccatt
tcacaagtttctgacacagcgacttattttaacttcttagcaagtcatgacggaattggt
atgcgccctgcgaccggaattctttccgacgaagaaatcaattctctcgtccaaaaagcg
gtccaaaacggtggacaagtttcctataaagacaatgcagatggcacgcagtcggtatat
gaacttaatattaactacggtgaagccttgcaaaatctagacgaagacacaaccgaagaa
ctcgtaacaaagaaaattatcgctgctcacagtattttactaacacttcaaggtgtccca
gcgatttactatcattcccttctaggctcaaaaaacgaccttgttggttatgaagaatca
ggtattaatcgtcgaattaaccgtgaaaaactggaaaaaaatcaattggttcatgaactt
aaaacagacacttatcgcaaaaccattttcacatcgctgaaaaaattggtgcaaatcaga
cgaaaccacaccgctttttcaccatttgcaacccaagaaattttagatttaggaccagat
gtttttgcgataaaacgggaatctgagggagaatgcatttatggaatcatcaacgttact
tctcacgatatcagcaaaaaagtcgctttctctggcactaatttgttagccaatcaaccc
gttacgagtgagctcgaattaactgcatatgaagttgtctggattaagaaggcggtccaa
tga

DBGET integrated database retrieval system