KEGG   Listeria monocytogenes serotype 4b LL195: BN389_00220Help
Entry
BN389_00220       CDS       T02416                                 

Gene name
ascB
Definition
6-phospho-beta-glucosidase AscB (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lmog  Listeria monocytogenes serotype 4b LL195
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lmog00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
23733..25166
Genome map
AA seq 477 aa AA seqDB search
MTESKFPKDFLWGGAVAANQCEGAYLEDGKGLSLVDILPTVEDGRWEALFNPAKALATDY
GFYPSHESIDFYHRYKEDIKLMAEMGFKCFRMSISWPRIFPNGDETTPNEKGLAFYDAVF
DECHKYGIEPVVTINHFDTPLEVFKKYGGWKNRKCIDFYLNFCEAIFTRYKDKVKYWMTF
NEINMILHLPYIGGGLDVTKEDNPEEVKYQAAHHQLVASALATKLGHEINPENQIGCMLA
AGNTYPMTCNPKDVWKSIEADREGYFFIDVQARGYYPSYTKRFFKEHNINIKMEDGDLDA
LRDHTVDYVAFSYYSSRLTSADPEKNKETEGNVFATLKNPYLKASEWGWQIDPLGLRITM
NTIYDRYQKPLFIVENGLGAVDTVAEDGSITDDYRIDYMREHVREMGEAIEDGVELLGYT
PWGCIDLVSAGSGEMKKRYGFIYVDRDNKGNGTLNRSKKKSFDWYKKVIETNGKDID
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgacagaatcaaaatttcctaaagactttttatggggcggagcagttgctgccaaccaa
tgtgaaggagcttatcttgaagacggtaaaggactttcacttgttgatatccttccaaca
gtagaggacggacgttgggaagctttattcaatccagcgaaagcgcttgctacagattat
ggtttttacccaagtcacgaatcaattgatttttatcatcgttataaagaagacattaaa
ttaatggcagaaatgggattcaaatgtttccgtatgtccatcagttggccacgtattttc
ccgaatggtgatgaaacgacaccaaatgaaaaaggtttagcattttatgatgcagttttt
gatgaatgtcacaaatatggtattgaaccagttgttacaatcaaccattttgatactccg
ctagaagttttcaaaaaatatggtggttggaaaaatcgtaaatgcatcgacttttacttg
aatttctgtgaagcaattttcacgcgttataaagataaagtaaaatattggatgacattt
aatgaaattaacatgattcttcatcttccatacattggtggaggtttagacgttactaaa
gaggacaatccagaggaagttaaatatcaagctgctcatcatcaattagttgcatcagca
cttgcaactaaacttggtcatgaaatcaatcctgaaaatcaaatcggttgtatgcttgca
gcgggtaacacatatccaatgacttgtaatccaaaagatgtctggaagtctatcgaggcg
gaccgtgaaggctacttcttcattgatgttcaagcacgcggatactacccaagctacact
aagcgtttcttcaaagaacacaacatcaacatcaaaatggaagatggcgacttagacgca
ttacgcgatcacacagttgattacgtggcattcagctactattcttctcgtctaacaagc
gcagatccagagaaaaacaaagaaacagaaggcaacgttttcgcaacactaaaaaaccca
tacctaaaagcaagcgaatggggttggcaaattgatccactaggtctacgtattactatg
aatacaatttacgaccgttatcaaaaacctcttttcatcgttgaaaatggcttaggtgca
gtggatactgtggcagaagacggctcaatcactgatgattacagaatcgactacatgcgt
gaacacgttcgcgaaatgggcgaagcaattgaggatggcgtggaacttcttggttataca
ccatggggctgcatcgaccttgtcagcgctggctctggcgaaatgaaaaaacgctacggc
ttcatctacgttgaccgcgataataaaggtaacggaaccctaaaccgctcgaagaaaaaa
tcattcgactggtacaaaaaagtaattgaaacaaatggtaaagatatcgactaa

DBGET integrated database retrieval system