KEGG   Listeria monocytogenes serotype 4b LL195: BN389_02870Help
Entry
BN389_02870       CDS       T02416                                 

Gene name
dapE
Definition
Probable succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
lmog  Listeria monocytogenes serotype 4b LL195
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:lmog01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:lmog00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
303128..304267
Genome map
AA seq 379 aa AA seqDB search
MERQRKIQILKDIVNIDSTNGHEEQVANYLQKLLAEHGIESEKVKYDVDRASLVSEIGSS
DEKVLAFSGHMDVVDAGDVSKWKFPPFEATEHEGKIYGRGATDMKSGLAAMIIAMIELHE
EKQKLNGKIRLLATVGEEVGELGAEQLTQKGYADDLDGLIIGEPSGHRIVYAHKGSINYT
VKSTGKNAHSSMPEFGVNAIDNLLLFYNEVEKFVKSIDATNEILGDFIHNVTVIDGGNQV
NSIPEKAQLQGNIRSIPEMDNETVKQVLVKIINKLNKQENMNLELIFDYDKQPVFSDKNS
DLVHIAKSVASDIVKEEIPLLGISGTTDAAEFTKAKKEFPVIIFGPGNETPHQVNENVSI
ENYLEMVDVYKRIATEFLS
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggaacgacaaagaaaaattcaaatcttaaaagacattgtgaatattgattcgactaat
gggcatgaagaacaagttgcgaactatttgcaaaagttgttagctgaacacggtattgag
tccgaaaaggtaaaatacgacgtagacagagccagcctagttagcgaaattggttccagt
gacgagaaagttttggcgttttcagggcatatggatgtcgttgatgcgggtgatgtctcg
aagtggaagttcccaccttttgaagcaacagagcatgaagggaaaatatacggacgtggc
gcgacggatatgaagtcaggtctagcggcgatgattattgcaatgattgagcttcatgaa
gaaaaacaaaaactaaatggcaaaattagattattagcaacggttggtgaagaagtcggt
gaacttggagccgaacaactaacgcaaaaaggttacgcagatgatttagatggcttgatt
atcggcgaaccgagtggacaccggattgtttatgcgcataaaggttccattaattatacc
gttaaatccactggtaaaaatgcgcatagttcgatgccggaatttggtgttaatgcgatt
gacaacttgttgctattttataatgaagtagaaaaattcgtgaaatcaattgatgctact
aacgaaatattaggcgattttattcataatgtcaccgtaattgatggtggaaatcaagtc
aatagtatccctgaaaaagcgcaactacaagggaatattcgctcgattccagaaatggat
aacgaaacagtgaaacaagtgctagtgaagattatcaataagttaaataaacaggaaaat
atgaatctagaattaatatttgattatgacaaacaaccagtatttagtgataaaaattcg
gatttagtccacattgctaagagcgtagcaagcgacattgtcaaagaagaaatcccatta
ctcggtatttccggaacaaccgatgcagcagaatttaccaaagctaagaaagagttccca
gtgattatttttggaccaggaaacgaaacccctcaccaagtaaacgaaaatgtttctata
gagaattatttggagatggtagatgtttacaaacgaattgccaccgagtttttatcgtga

DBGET integrated database retrieval system