KEGG   Listeria monocytogenes serotype 4b LL195: BN389_06110Help
Entry
BN389_06110       CDS       T02416                                 

Gene name
gmuD_2
Definition
6-phospho-beta-glucosidase gmuD (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lmog  Listeria monocytogenes serotype 4b LL195
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:lmog00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN389_06110 (gmuD_2)
Enzymes [BR:lmog01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     BN389_06110 (gmuD_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
617833..619227
Genome map
AA seq 464 aa AA seqDB search
MTYKFPENFWWGSAASGPQTEGAANVDGRKPSIWDHWYKIEPGRFFNDVGPTNTSNFYYQ
YKEDIALMKQTGHNSFRTSIQWSRLIPDGIGEVNPKAVDFYNRVIDEMLANDVEPFMNLY
HFDMPMSMQEKGGFESREVVDAYATFAKTCFELFGDRVKHWFTFNEPIVPVEAGYLYDMH
YPNVVDFKRATQVAYHTTLAHALAVKEFHALEIPEGQIGIILNLTPSYPRSQNPADLKAA
HIADLIFNRSFLDPVTKGEFPADLVEIIREHDALPEYTEEDLAIIKNNIIDILGVNYYQP
RRVKAKEYAAHPDAPFMPEHLFDNYEMPYRKMNPYRGWEIFERAIYDIAINLRDNYDNIP
FFISENGMGVEGESRYRNADGMIEDTYRIDFIKSHLKWLHKAIEEGSNCHGYHLWTFMDC
WSWANAYKNRYGLVEVDLDNNFKRTIKASGHWYKELSENNGFED
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgacttataaatttccagagaatttttggtggggaagtgcggcgtccggcccacaaaca
gaaggcgcagcaaatgtagatggcagaaaaccgagtatttgggatcactggtacaaaatc
gaaccaggtcgtttctttaacgatgtaggacctacgaatacatctaatttttactatcaa
tataaagaagatattgctttaatgaaacaaactgggcataattctttccgtacttcgatt
cagtggtcacgtcttattccagatggtattggcgaagtgaatccgaaagcggttgatttt
tacaatcgcgttattgatgaaatgcttgcaaatgacgtggaaccatttatgaatttatat
cattttgatatgccaatgtcgatgcaagaaaaaggcggttttgaaagccgtgaagtagtt
gacgcgtatgcaacttttgcgaaaacatgttttgaattattcggagatcgtgtgaaacat
tggtttacttttaatgaaccaattgttcctgttgaagcaggttacttatacgatatgcac
tatccgaatgtcgttgattttaaacgtgcgactcaggttgcttaccatactactttggca
catgcgcttgctgttaaagaattccacgcacttgaaattccagaaggccaaatcggaatc
attttaaacttaacgccgtcgtatccaagaagccaaaatccagctgatttaaaagcggct
catattgcagatctaattttcaaccgtagtttccttgatccggttacaaaaggggaattc
ccagctgaccttgttgaaattattcgcgaacatgacgcgcttccagaatatactgaagaa
gatttggcgataattaaaaacaacattattgatattcttggtgtaaactactaccaaccg
cgtcgtgtgaaagcgaaagaatacgcagctcatccggatgcaccatttatgccagaacat
ctttttgataactatgaaatgccttaccgcaaaatgaatccatatcgtggttgggaaatt
ttcgaaagagcgatttatgatattgcgattaatctgcgtgataactacgataatattcca
ttcttcatttctgaaaatggtatgggtgtagaaggcgaaagtcgctaccgtaatgcagac
ggaatgattgaagatacgtaccgaatcgatttcattaagagtcacttgaaatggctgcat
aaagccattgaagaaggttctaactgtcatggttatcatctttggacattcatggattgc
tggagctgggcgaatgcttacaaaaaccgttatggcttagtagaagttgatttagacaat
aatttcaaacgtactataaaagcatccggacattggtacaaagaactttcagaaaacaat
ggttttgaagactaa

DBGET integrated database retrieval system