KEGG   Listeria monocytogenes serotype 4b LL195: BN389_08580Help
Entry
BN389_08580       CDS       T02416                                 

Gene name
fbp
Definition
Fructose-1,6-bisphosphatase class 3 (EC:3.1.3.11)
Orthology
K04041  
fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
lmog  Listeria monocytogenes serotype 4b LL195
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:lmog01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lmog00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:lmog00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:lmog00051]
Metabolism; Energy metabolism; Methane metabolism [PATH:lmog00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(859690..861714)
Genome map
AA seq 674 aa AA seqDB search
MPCLHLRNIIAIPIEKGGTGLVKTIDMKYLRLLAKEYPTIAKTATEIINLEAIMNLPKGT
EHFLSDVHGEYSAFEQVLRNGSGVVKRKIRDIFGAELDDAEINSLSTLIYYPEEKMDLLA
SETEDLQAWYRTTLFRLIELCQYVASKYTRSKVRKAMPEDFAYILEELLHENYNEDDKKL
YYEEILQHIISLGRAEEFISALSLLIQQLVVDHLHIVGDVYDRGPYPDKIMDTLMNYHSL
DFQWGNHDILWMGAASGSRVCAANVIRISARYLNLDILEDSYGISLRPLALFADEVYKDD
PCTYFQPKNEENINYSNAEITQIARMHKAISIIQFKLEGEIINRRKEFDMDHRLLLQFID
YKKGTIHLKGKEYLLLDSHFPTINPEKPYELTDAERELIGKITAAFKNCRRLQKHVQFLY
SKGSMFLTYNGNLLYHGCIPLHEDGTFMEMKLRGEKYAGRSLLEQFEILTREAYVRPTGT
KEKKYACDIVWYLWTGAISSLFGKSEMTTFERYFVAEKETHTEEKNPYYKLRNNELICKQ
ILEEFGLDGECGHIINGHTPVKEGKGESPIKANGKMLVIDGGFAKAYHKETNLAGYTLLF
NSYGLQLVSHQPFTTKEDAIKNETDILSTRQVIEMEINRKRVRDTDIGAKLSEQAEDLKL
LLDAYRNGLLHENR
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
ttgccttgcttacatttaagaaatataatagctataccaattgaaaaaggaggtactgga
ctggtgaaaactattgatatgaaatatttacgcttgttagcaaaagaatatcctactatt
gccaagacagctacggaaatcattaatctcgaagcaattatgaaccttccaaaaggaacg
gaacattttttaagtgatgttcacggtgaatatagtgcttttgaacaagtgcttcgtaat
ggttctggtgttgtaaaacggaaaattcgtgatatttttggcgcggagctagatgatgca
gagattaattcacttagtacactgatttattatccagaagaaaagatggatttgcttgct
agtgaaacagaagatttgcaggcttggtatcgcaccacactttttcgtttgattgaactc
tgccagtacgttgcttcaaaatacacacgttctaaagtgagaaaagccatgcccgaagat
tttgcctacatattagaagagttacttcatgaaaactacaatgaagacgacaaaaagctt
tattatgaagaaattttacaacatattatttcacttggtcgtgcagaagaatttattagt
gctctctcgttacttattcaacaattggtcgtcgatcatttgcacattgttggtgatgtc
tatgatcgtggtccttatccagataaaatcatggatacattaatgaattaccattcgctc
gatttccagtggggtaatcacgatattttgtggatgggcgcggctagtggttctagggtt
tgtgcggctaatgttattcggatttctgcccgttatttaaatttagatattttagaagat
agttacggtatttctcttcgccccctggccctttttgccgacgaagtgtacaaagacgat
ccttgtacctacttccagcccaaaaacgaagaaaatattaactatagtaatgcagaaatc
acgcaaattgctaggatgcataaggctatctcgattattcagtttaaattggaaggtgaa
attataaatcgacgcaaagaatttgatatggatcaccgacttttacttcaatttatcgat
tataaaaaaggcacaattcatctaaagggaaaagaatacctgttgttagacagtcatttt
ccaacgattaatccagaaaaaccttatgaactcactgacgcggagagagaacttattggg
aaaattactgccgcttttaaaaactgtcgtcgattgcaaaaacatgtacaatttctatat
tcaaaaggcagcatgtttttaacttataatggtaatttactctaccatggctgcattcca
ctccacgaagatgggacttttatggaaatgaaattacgtggcgaaaaatatgctggtcgt
tcgcttttagagcagtttgaaatacttacccgcgaagcatacgtacgtccaactggaact
aaagaaaagaaatatgcgtgtgatatcgtttggtatttgtggactggtgccatttcttcg
ctatttggaaaaagtgaaatgactacatttgaacgttattttgttgcagaaaaagaaaca
cacacagaagaaaaaaatccttactacaaattgcgtaataacgaattaatttgcaaacaa
attttagaagaatttgggcttgatggtgaatgcgggcatatcattaacggccatacgcca
gtcaaagaaggaaaaggtgaaagtccgattaaagcgaatggtaaaatgctcgtcatcgat
ggcgggttcgcaaaggcctatcataaagaaacgaacttagcgggttatacactacttttt
aatagttacggtttacaattagtgagtcatcagccatttactacaaaagaggatgctatc
aaaaatgaaacggatattctttccacgcgtcaagttattgaaatggaaattaaccgtaaa
cgtgtaagggataccgatattggggctaaacttagtgagcaggcagaagatttaaaattg
ttactagatgcctatcgtaatggcttgcttcatgaaaaccgttaa

DBGET integrated database retrieval system