KEGG   Listeria monocytogenes serotype 4b LL195: BN389_10660Help
Entry
BN389_10660       CDS       T02416                                 

Gene name
glpK1
Definition
Glycerol kinase 1 (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
lmog  Listeria monocytogenes serotype 4b LL195
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:lmog00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1063665..1065128
Genome map
AA seq 487 aa AA seqDB search
MKKHYQIAIDQSTSGTKVLLFKAGELVDRLDKKHRQLYPKKGWVEHNPIEICQNVRTLIV
DILAKHDLIPADIERLALTNQRETIVAWDKQTGKPLYNAIVWQCNRTKELCETLKKAGYE
KRIKQLTGLKIDSYFSASKMKWLLENSSAVRDAASRNQLAFGTMDAWLLFSLTDDSNYFT
DRTNASRTLLYDIEKNDWSDELLELFGVKRAYLPEVKQSAGSFGSYQEIPIHSVMADSEA
ALYGQGCDAFGAVKATLGTGCSVMMQIGENRLPENDAILTTLAWDVAGVNQFALEGIIRS
CGDTLVFLSEQLELFNDYDTACKRAFQLPCNEGVVLIPGQLGLGSPYWNTDIRAEILGLT
REHTKWHIIRAGFTSIAFQIKAVIDQMELMTGQNIKRLQVDGGLTKQHELMQYLADVLKA
EVAVSPAEELSAIGAIEIADNKLQNKRTIAKLYQPNITHTHALEDFQEWEKQVKSSILKL
QKVRNFK
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaacactatcaaatcgctattgatcaaagcacatctggaacgaaagtattattg
tttaaagcaggtgaacttgtagatcgtttagataaaaagcatcgacagttgtatccgaag
aaaggctgggtagagcataatccaatcgaaatttgtcaaaatgtccgtacattaattgtg
gacatattggcaaaacatgatttaattccagcggatatcgagcgacttgctttgacgaat
caacgggaaacaattgtagcttgggataaacaaacgggcaagccactttataatgcgatt
gtatggcaatgtaatcgaacaaaagaactttgcgaaacattaaaaaaagctggttatgaa
aaaagaattaaacagcttaccggattgaaaattgattcttatttttctgcttctaaaatg
aagtggttattggaaaatagttctgcggtgcgggatgcagcaagtcgtaatcaattggca
tttggtacaatggatgcttggttgttattttcgcttacggatgatagtaattatttcaca
gaccgaacaaacgccagccgcacactcctttatgatattgaaaaaaatgattggtcagat
gagttactcgaactttttggagttaaacgtgcttatttaccagaagtgaagcaatctgct
ggaagttttggaagttatcaggagataccgattcatagtgtgatggctgattcagaagcg
gcactttatggacaaggctgtgatgcatttggggcagtgaaggcgacgcttgggacagga
tgctctgttatgatgcaaattggtgagaacagattacctgaaaacgatgctattttgaca
actcttgcctgggatgttgcaggcgtgaaccagtttgcgttagaaggaattattcgttct
tgtggagacacattggtttttttatccgaacaattagaactatttaatgattacgataca
gcttgtaagcgagcatttcaattaccatgcaatgagggtgttgtgctaattcctggacaa
ttaggtttaggttcgccttattggaatacagatatacgagcagagattcttggtctcaca
cgagaacatacaaaatggcatattattcgtgccggttttacaagtattgcatttcaaatt
aaggctgttattgaccaaatggagttaatgacaggtcaaaatattaagcgcttacaagta
gacggtggattaacaaagcaacatgagttgatgcaatatttagcagatgttttaaaagca
gaagtggcagtcagtcccgcggaagaactttcggcaattggtgctattgaaattgccgac
aataaactacaaaataagagaacgatagcaaaattgtaccaaccaaatatcactcataca
catgctttggaagattttcaagaatgggaaaaacaagtgaaaagcagtattctaaaatta
cagaaggtgaggaattttaaatga

DBGET integrated database retrieval system