KEGG   Listeria monocytogenes serotype 4b LL195: BN389_11120Help
Entry
BN389_11120       CDS       T02416                                 

Gene name
cap4C
Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lmog  Listeria monocytogenes serotype 4b LL195
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lmog00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BN389_11120 (cap4C)
   00052 Galactose metabolism
    BN389_11120 (cap4C)
   00500 Starch and sucrose metabolism
    BN389_11120 (cap4C)
   00520 Amino sugar and nucleotide sugar metabolism
    BN389_11120 (cap4C)
Enzymes [BR:lmog01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BN389_11120 (cap4C)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1113459..1114367)
Genome map
AA seq 302 aa AA seqDB search
MRRRLLNMRVKKAVIPAAGLGTRFLPATKAMPKEILPIVDKPTIQYIVEEAVASGIEDIL
IVTGKGKRAIEDHFDSVPELENNLREKNKLELLHLVEQTTNINLHFIRQAKPKGLGDAIL
QAKGFVGNEPFIVMLGDDIVESKIPCSKQLMNQYEKTHSSVIGVQTVPHEETYRYGIIDP
INEYDKNLYNVKGFVEKPDPANAPSDLAILGRYLLTPQIFDFLETQKPGAGGEIQLTDAI
NSLNEVQRVFAYDFEGQRFDVGDKFGFIQTTMQFALKHPEIKDDVKDLINDLYNQIHKKD
KK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
attagaaggagattattaaatatgagagtaaaaaaagctgtaattccagctgctggtcta
ggcacgcgctttttaccagcaacaaaagcaatgcctaaagaaatcttaccaattgtggat
aaaccaactattcaatacatagtagaagaagcagtagcatctggcatagaagatatttta
attgtaaccggtaaaggtaaacgtgctatcgaagaccattttgattccgttcctgaactt
gaaaacaatctacgggaaaaaaataaacttgaattactacatttagtagaacaaactact
aacattaatttgcactttattcgtcaagcgaaaccaaaaggacttggtgatgccatcctt
caagcaaaaggctttgtgggtaatgaaccatttatcgttatgttaggtgatgatattgtt
gaatccaaaatcccttgttccaaacaattaatgaatcaatatgaaaagacgcatagttcc
gtcattggagtccaaactgtccctcacgaagagacatatcgttatggtattattgatcca
attaatgaatatgataagaatttatataatgtgaaaggttttgtggaaaaaccagatcct
gctaatgcaccgtctgatttagctatccttggccgttacttattaacaccacaaattttc
gacttcttagaaacgcaaaaaccaggtgcaggaggcgaaattcaactaaccgatgcaatc
aatagtctaaatgaagtacaacgtgtatttgcttatgactttgaaggacagcgttttgat
gttggcgataaattcggctttatccaaacaacaatgcaattcgctttgaagcatcctgaa
atcaaagatgatgtgaaagatctgattaacgacttatataaccaaattcataaaaaagat
aaaaaataa

DBGET integrated database retrieval system