KEGG   Listeria monocytogenes serotype 4b LL195: BN389_13630Help
Entry
BN389_13630       CDS       T02416                                 

Gene name
glcK
Definition
Glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
lmog  Listeria monocytogenes serotype 4b LL195
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lmog00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BN389_13630 (glcK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN389_13630 (glcK)
   00052 Galactose metabolism
    BN389_13630 (glcK)
   00500 Starch and sucrose metabolism
    BN389_13630 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    BN389_13630 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BN389_13630 (glcK)
   00524 Butirosin and neomycin biosynthesis
    BN389_13630 (glcK)
Enzymes [BR:lmog01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BN389_13630 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1346147..1347115
Genome map
AA seq 322 aa AA seqDB search
MNKKLIGVDLGGTTAKLAILTKEGDIEEKWTIDTNIEDKGAHIVKNIGDSINQKLTDLQL
DNDIFYGIGMGTPGTVNYETGTVKGAYNLGWADEQNVSQDLENITGLKIILDNDANVAAL
GERWKGAGEGGANVVFVTLGTGVGGGIFAEGKILHGIRGAAGEIGHVTVVPENGYDCTCG
KKGCLETVASATGIVRVAKDLAKEYTGKSALKDAINNDETITSKLIFELGAEDDALANET
IDKISFYLALALSHIGNMLNPEKIIIGGGVSAAGDQLLTPVKTYFETMVFPAVKESTKLS
IATKGNDAGIIGAAWLALPSED
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaaaattaattggtgtagatttaggcgggacaacagcaaaattagctatttta
acaaaagaaggcgacattgaagaaaaatggacaattgatacaaatattgaagataagggc
gcccacattgttaaaaacattggggattctatcaatcaaaaattaacggacttacaactg
gataatgatattttttatggtattggtatgggaactccaggtactgtaaattatgaaaca
ggtactgtaaaaggtgcgtacaacttaggctgggcagatgaacaaaatgttagtcaagat
ttagaaaatattactggtttaaaaatcatattagataatgatgctaatgttgcagctctt
ggtgaacgctggaaaggcgcaggcgaaggtggggctaatgtcgttttcgtaacacttgga
acaggcgttggcggcggaattttcgcagaaggcaaaattttacatggtattcgcggagca
gctggtgaaattgggcatgtaacagtagttcctgagaatggttatgattgtacctgtggc
aaaaaaggctgtttagaaactgtcgcatcagcaacaggaatcgttcgagtagcgaaagat
ttagcgaaagagtatactggtaaatccgcacttaaagatgcaataaacaacgatgaaaca
attacttctaaattgatttttgaactaggagcagaagatgatgctttagcaaatgaaaca
attgataaaatttctttctatttggctttagcgctcagtcatattggaaacatgttaaat
ccagagaagattattattggtggtggcgtttcagcagcaggcgatcaattattaacaccg
gttaaaacttattttgagacaatggttttcccagctgttaaagaatccactaaattatct
attgcgacaaaagggaatgacgcagggataattggagctgcatggttagcactaccaagt
gaagattaa

DBGET integrated database retrieval system