KEGG   Listeria monocytogenes serotype 4b LL195: BN389_15800Help
Entry
BN389_15800       CDS       T02416                                 

Gene name
hemD_2
Definition
Uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
lmog  Listeria monocytogenes serotype 4b LL195
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lmog00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BN389_15800 (hemD_2)
Enzymes [BR:lmog01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     BN389_15800 (hemD_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1571154..1571876)
Genome map
AA seq 240 aa AA seqDB search
MSKKVVLTREANKNKPWQTYFSQNGFEVTSIPLIKTRPIKMDLSREQQQTDWLFLTSANA
VEYFFTIQHERFNYKIAVIGEKTKEKLAEFGHEPNFVPSIYQSEVFLEEWLNENPEKTSI
LIPQSNLSRTIIKDRLIEKGYIVVSFELYETIFPENSKIRLIEQLKLNETQIIVFASPSA
WKNFYSTAKSFPAQKEKWHIASIGSITTEAIIADGWEVKYQPKTFTMKHLADLIIQEELK
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaaaagttgttttaacaagagaagcgaataaaaacaaaccatggcaaacctat
ttttcgcaaaatggttttgaagtgacgtcaatcccgctgattaaaacacgacctataaaa
atggatttgagtcgagaacaacaacaaacagactggctttttttaacaagtgcaaatgct
gtagaatatttctttacgatccaacatgaaagattcaattataaaatagctgtcatcggt
gaaaaaacaaaagaaaaactggcagaatttggtcacgaaccaaattttgtcccatctatc
tatcagtcagaagtatttttagaagaatggctaaacgaaaacccagagaaaacaagtatc
ttaataccacaaagtaatttaagcagaacaataataaaagatagattgattgaaaaaggt
tacatcgttgtttcgtttgagctctatgaaacaatctttccagaaaattctaaaatacgg
ttaatcgaacaactgaaactaaatgaaacacaaataattgtttttgccagcccatctgca
tggaaaaacttctattccactgcgaagtcattccctgctcaaaaagagaagtggcatatt
gcatccattggtagtattacaacagaagccattatagcagatggatgggaagtaaaatat
caaccaaaaaccttcaccatgaagcacctagctgatttgataatacaggaggaattaaaa
tga

DBGET integrated database retrieval system