KEGG   Listeria monocytogenes serotype 4b LL195: BN389_16430Help
Entry
BN389_16430       CDS       T02416                                 

Gene name
ytjP
Definition
Putative dipeptidase ytjP (EC:3.4.13.-)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
lmog  Listeria monocytogenes serotype 4b LL195
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lmog00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BN389_16430 (ytjP)
  Amino acid metabolism
   00300 Lysine biosynthesis
    BN389_16430 (ytjP)
Enzymes [BR:lmog01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     BN389_16430 (ytjP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1640815..1642263)
Genome map
AA seq 482 aa AA seqDB search
MEKISLKEGITIMTEINWQKEVESRKDDFLEDLKGLLRIPSVRDDSKKTEDAPFGPDVKR
ALDYMIELGKKDGFTAKEVGNVAGHLEYGQGEELVGVLGHVDVVPVGDGWTNGPFEPTLR
DGKLYARGVADDKGPTIAGYYALKIIKELGLPLSRRVRIIVGSDEESGMSCVERYFETEE
QPTLGFVPDAEFPIIHAEKGISELDVSFKDGEASGEAAFRLLSVESGERYNMVPDHATAI
LEDVKDFDKLASAFKTFLANHPVEGTLEENGKSVKINIVGKSAHAMEPNNGVNAGLHLVA
FLGKFKLTGAANDFVTFGRDYLFGDSRAVKLGISYEDEESGELTMNVGVIRYDVAEGGKY
GLNFRYPVTANMDKLKNKMQTVVYEYNAQYTHYEDSKPLFVPKDHPLIQVLQEVYTKQTG
EEATLLAIGGGTYARHMETGVAFGALFPGREDTMHQKDEFSYFDDLLKATAIYAEALYKL
AK
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atagagaagataagtttgaaggagggaataacaattatgacagaaattaattggcaaaaa
gaagtggaatcacgcaaagatgatttcttagaagatttaaaagggcttcttcgcattccg
agtgttcgcgatgacagtaaaaaaacagaagatgcgccgtttggaccagacgtgaaacgc
gcgctcgactatatgattgaacttggtaaaaaagacggcttcacagcgaaagaagttgga
aacgtagcaggacaccttgaatatggtcaaggagaagaactagttggcgttttaggccat
gtggatgtagtaccagttggtgatggttggacgaacggaccattcgaaccaactttacgc
gacggcaaattatacgctcgtggggttgcggacgataaaggaccaacaatcgcaggttac
tatgcgctaaaaattattaaagaactaggattaccactttctcgccgtgttagaatcatt
gttggttctgatgaagagagcggtatgagctgtgtggaacgttattttgaaacagaagaa
caaccaacacttggttttgttcctgatgcagaattcccaatcattcacgcggaaaaaggt
atctcagaactagatgtatcttttaaagatggtgaagcaagcggggaagcggctttccgt
ttacttagcgtagaatcaggtgagcgttacaacatggttccagatcacgcaacagctatt
ttagaagacgtaaaagactttgataaattagcgagtgcattcaaaaccttcctagcaaac
catccagtagaaggaacattagaagaaaacggcaaatccgttaaaattaatattgttggt
aaatctgcccatgcaatggaaccaaataacggtgtaaacgctggtcttcatttagtagct
ttccttggtaaattcaagctgactggcgcggcaaatgatttcgtaacatttggtcgcgat
tacctattcggcgattcccgtgcagttaaattaggtattagctatgaagacgaagaaagc
ggcgaactaacaatgaacgttggcgttattcgttatgatgtagcagaaggtggaaaatac
ggacttaatttccgttatccagtaactgctaatatggacaaattgaaaaataaaatgcaa
acagtggtttatgagtacaacgcgcaatacacgcattacgaagattccaaaccacttttc
gtaccaaaagatcatccgctaattcaagttttacaagaagtgtatacaaaacaaacgggt
gaagaagctactttactagcaattggtggcggaacttatgcgcgccacatggagactggt
gtggcgttcggcgcactattcccaggccgtgaagacacgatgcaccaaaaagacgaattc
agctattttgatgatttgttaaaagctactgcaatttatgcagaagcactttacaaatta
gcgaagtaa

DBGET integrated database retrieval system