KEGG   Listeria monocytogenes serotype 4b LL195: BN389_16530Help
Entry
BN389_16530       CDS       T02416                                 

Gene name
trpC
Definition
Indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
lmog  Listeria monocytogenes serotype 4b LL195
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lmog00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BN389_16530 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BN389_16530 (trpC)
Enzymes [BR:lmog01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     BN389_16530 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1650857..1651657)
Genome map
AA seq 266 aa AA seqDB search
MGRFNYLSKRGASKMTFLEEILAQKAVEVADMPLEKVAEKRKTYSFYEFLKANTSTMQLI
AEVKRASPSKGEINMGVNPVLQAKSYQAAGAGMISVLTDPVFFKGSIEDLREVAKNVEIP
VLCKDFIISEKQLIRARNAGATVVLLIISALTEEMLIALFEQALALDLEVLVEVHDQKEL
AVAQKIGAKLIGVNNRNLHTFEVDIAVSERLASDFSSDACFISESGFRTAEDVARVSQKY
NAVLVGEALMREATPEAAAKSLKVTR
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
attggcagatttaattacttatcaaaaagaggtgctagcaaaatgacatttttagaagaa
attttagcgcaaaaagcagtagaagttgcagacatgcccttagaaaaagtagccgaaaaa
cggaaaacttattcgttttatgaatttttaaaagcaaataccagcacgatgcaacttatt
gcagaagtaaaacgcgcctctccttctaaaggggaaatcaatatgggcgtgaatccggtt
ctgcaagccaagtcttatcaagctgcgggtgcgggaatgatttctgttttgacagatcct
gtttttttcaaaggctcgattgaagatttgcgagaagtagcgaaaaatgtcgaaattcct
gtactttgtaaagattttattattagtgaaaaacaattgattcgtgctcgaaatgcggga
gcaacggttgtattgctaattatttcggcacttacagaagagatgctaattgctctgttt
gaacaagctctggcgcttgatttggaagtgttagtggaagtacatgaccagaaagaatta
gctgttgctcaaaaaattggagctaaactcattggtgtgaacaaccgtaatttgcataca
tttgaagtggatattgcagtaagtgaaagactggcgagcgatttctcgtcggatgcttgt
ttcataagtgaatcaggttttcgaacagctgaagatgtggctcgggttagtcaaaaatat
aatgcagtacttgttggagaagcgctaatgcgagaagcgactccagaagcagcggcgaaa
agtttgaaggtgacacgatga

DBGET integrated database retrieval system