KEGG   Listeria monocytogenes serotype 4b LL195: BN389_16910Help
Entry
BN389_16910       CDS       T02416                                 

Gene name
asnB
Definition
Asparagine synthetase [glutamine-hydrolyzing] 1 (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
lmog  Listeria monocytogenes serotype 4b LL195
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lmog00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BN389_16910 (asnB)
Enzymes [BR:lmog01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     BN389_16910 (asnB)
Peptidases [BR:lmog01002]
 Cysteine Peptidases
  Family C44
   BN389_16910 (asnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1694149..1696014)
Genome map
AA seq 621 aa AA seqDB search
MCGFVGCVHDRITEITGADKETFRQMNSMITHRGPDDEGYFTDDHVQFGFRRLSIIDVEN
GHQPLTYENERYWIIFNGEVYNYVELREQLVAEGMTFETESDTEVIIATYAKYKEKTAER
LRGMFGFVIWDKQEELVYGARDPFGIKPFFYAEEDGKLFMGSEKKSILHALKEKELDEVS
LQNYMTYQFVPEPDSLTKNVKRLEPGHQFTKKIGQPMEITTYWKASFAPVTKSEDAWIKE
VRDVMYDSVKMHMRSDVPVGSFLSGGIDSSIIAAIAKEYHPAIKTFSVGFERDGFSEIDV
AKETADKLGVENISYVISPEEYMKELPKIVWHMDDPLADPAAIPLYFLSREARKQVTVAL
SGEGADELFGGYNIYNEPNSLAMFNKMPSVFKSMLNSVARIMPEGMRGKSFLERGTTPME
ERYIGNAKMFTEKEKQILLPKYQAGHDYTNITDPFYAETTNYHPVERMQYIDIHTWLRGD
ILLKADRMTMANSLEVRVPFLDKEVYNVARNIPDTMKTTNGTTKYILRKAAATFVPEHVL
NRRKLGFPVPIRHWLKDEMNAWVKNIIKESPTDHLINKQYVLGLLDDHCAGKFDYSRKIW
TVVIFMIWYDVYVADKYDFGK
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggatttgtaggatgcgtacatgaccgcattacagaaattactggcgctgataaa
gaaacctttagacaaatgaacagtatgattacgcaccgtgggccagatgatgaaggatac
ttcacagatgatcacgtgcagtttggtttccgccgtttaagtattattgatgtagaaaac
ggtcatcaaccgttaacgtatgaaaatgaacgttactggattatttttaatggagaagtt
tataactatgtggaactccgtgagcaattagttgctgaaggaatgacatttgaaaccgaa
agtgataccgaagtaattatcgctacatatgcgaaatacaaagaaaaaacagcagaacgt
cttcgtgggatgtttggtttcgttatttgggataaacaagaagaacttgtttacggcgca
cgcgacccatttggcattaaaccatttttctatgcagaagaagatggcaaattgttcatg
ggttctgaaaagaaatccattctacatgctttaaaagaaaaagaattggatgaagtttca
ttacaaaactatatgacttaccaattcgttccagaaccagattccttaactaaaaatgta
aaacgtttagaaccaggacatcagttcacgaagaaaattggtcaaccaatggaaattact
acttattggaaagcatcttttgcaccagtaactaaatcagaagacgcatggattaaagaa
gtgcgtgacgtaatgtacgattctgtaaaaatgcatatgcgctctgatgtaccagttggt
tcattcctatctggtggtattgattcatcgattattgctgcgattgctaaagaatatcat
cctgcaatcaaaacattctctgttggttttgaacgcgatggtttcagtgaaatcgatgtc
gcaaaagaaacagcagacaaacttggcgtagaaaacattagttatgttatctcacctgaa
gaatatatgaaagaattaccaaaaattgtttggcatatggatgatccacttgctgatcca
gctgctattccgctttacttcttatcaagagaagcgcgcaaacaagtaacggttgcattg
tccggtgaaggtgcagatgaacttttcggtggttataacatttataacgaaccgaattcc
cttgcgatgtttaacaaaatgccaagcgtatttaaatcaatgctaaatagcgtggcgcgc
attatgccagaaggtatgcgtggtaaaagtttcttagaacgtggaaccactccgatggaa
gaacgctatatcggaaacgccaaaatgttcacggaaaaagaaaaacaaattttacttcca
aaatatcaagctggtcatgactatacgaacattacagatccattttatgcagaaacaacg
aattatcatcctgtagaaagaatgcagtacattgatattcatacgtggcttcgcggagat
attcttctcaaagctgaccgcatgacgatggctaattcgctggaagtccgtgtacctttc
cttgataaagaagtgtacaatgtggcaagaaatattccagatacaatgaaaacaaccaat
ggaacaacaaaatatatcttacgtaaagcggcagcaacatttgtaccagaacacgtactt
aaccgccgtaaactaggattcccagtaccaattcgtcactggttaaaagacgaaatgaac
gcttgggttaaaaacatcattaaagaatcaccaacagatcatttaattaacaaacaatac
gttctaggattactagacgatcactgtgccggtaaattcgactacagtcgtaaaatctgg
acagttgttattttcatgatttggtatgatgtatacgtagcagataaatacgattttgga
aaataa

DBGET integrated database retrieval system