KEGG   Listeria monocytogenes serotype 4b LL195: BN389_19580Help
Entry
BN389_19580       CDS       T02416                                 

Gene name
folE
Definition
GTP cyclohydrolase 1 (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
lmog  Listeria monocytogenes serotype 4b LL195
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:lmog00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1988127..1988822)
Genome map
AA seq 231 aa AA seqDB search
MYLRKQKNPYYYHLFKQIKFTLKFGCVKIYKVYNAKKIGELRMEQIDKQKIADAVKVILE
AVGENPEREGLIDTPMRVARMYEEVFAGLKKDPSVHFDTIFEEQHEELVLVKDIRFSSMC
EHHLVPFFGVAHVAYLPQNGRVAGLSKLARVVDDVSRRPQLQERITTTVAEIMMEKLKPL
GVMVIMEAEHMCMTIRGVNKPGTKTITSAVRGAFKNDDKLRSEVLALIKHN
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atatacttacgaaagcaaaaaaacccctattattatcacttattcaagcaaattaaattt
accttgaagtttggctgtgttaagatatacaaggtatataatgctaaaaagataggggaa
ttaaggatggagcaaatagacaagcaaaagattgctgacgcggtaaaagttattttagaa
gcagtaggagaaaatccagaacgtgaaggactgattgatacaccaatgcgagtagctcgt
atgtatgaagaagttttcgctgggctgaaaaaagatccttctgttcatttcgatactatt
tttgaagaacaacatgaagaattagtacttgtgaaagacattcgcttttcgtctatgtgt
gaacatcaccttgtccctttttttggagtagctcatgtagcatacttaccacaaaatgga
agagttgctggtcttagtaaacttgctcgcgtagtggatgatgtaagtcgccgcccgcag
ttacaagaacggataacaacgactgttgcagaaattatgatggaaaaactaaaaccgttg
ggtgtaatggtcatcatggaagcagagcatatgtgcatgactatccgcggtgtaaataaa
cctggaacaaaaacaattacaagtgctgttcgtggtgcttttaaaaatgacgataagctt
agaagtgaagttttagctttaattaagcataattaa

DBGET integrated database retrieval system