KEGG   Listeria monocytogenes serotype 4b LL195: BN389_24130Help
Entry
BN389_24130       CDS       T02416                                 

Gene name
est
Definition
Carboxylesterase (EC:3.1.1.1)
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
lmog  Listeria monocytogenes serotype 4b LL195
Brite
Enzymes [BR:lmog01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     BN389_24130 (est)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2477030..2477818)
Genome map
AA seq 262 aa AA seqDB search
MNQTSKKNQGAIFTMKITPPQPFLFEKGKRAVLLLHGFTGSSADVRILGRFLQENNYTCY
APQYRGHGVSPDLLLKTGPNDWWEDVLEAYDHLKSLGYTEIAVAGLSLGGLFSLKLGFSR
PLKGIIAMSTPTRMDSSSPIIQGFLDYVRNYKKLEGKTPEQIDAEMVAYKDAPMNTIAKL
KDEINGVVAEIDMIYAPIMVVQGEKDDMVDVSGAQLIYDTVESTKKELHWFKESGHVITL
DKERKEVNQAILTFLDSLDWQE
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atcaaccaaacctccaaaaagaaccaaggagcgatatttactatgaaaataacaccacca
caaccattcctattcgaaaaaggcaaaagagcagtgttactcttgcacggtttcacaggt
agctcagcggatgtaagaatattaggtaggtttttacaagaaaacaattatacttgctat
gcacctcaatacagaggccacggtgtatctcctgacctactgttaaaaacgggaccaaac
gattggtgggaagatgttcttgaagcctatgatcacctaaaatcacttggttacacggaa
atagctgtggcgggactttcactcggtgggcttttttcactaaaattaggtttttctagg
ccgttaaagggaattatagccatgagtactccaacaagaatggacagttcatcaccaata
attcaaggctttttagattatgtgcgtaattataaaaaattagaaggtaaaacacctgaa
caaatcgatgctgaaatggttgcctataaagacgccccaatgaacacaatcgctaaacta
aaggacgagataaatggcgtcgtggctgaaatagatatgatttatgcgccaataatggtc
gtccaaggtgaaaaagacgatatggttgatgtgagcggagcacagctaatttatgataca
gtagagtcaacgaagaaagaattgcactggtttaaagaatctgggcacgtcatcacatta
gacaaagaacgaaaagaagtaaatcaagccattttaacatttttagatagtttagattgg
caagaatag

DBGET integrated database retrieval system