KEGG   Listeria monocytogenes serotype 4b LL195: BN389_25080Help
Entry
BN389_25080       CDS       T02416                                 

Gene name
thrC
Definition
Threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
lmog  Listeria monocytogenes serotype 4b LL195
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:lmog00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BN389_25080 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BN389_25080 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BN389_25080 (thrC)
Enzymes [BR:lmog01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BN389_25080 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2576308..2577387)
Genome map
AA seq 359 aa AA seqDB search
MFRCGGLNMYKGLLEKYKEYLPVTDKTPMISLAEGNTPLIPLPNLSKELGVTLYGKYEGL
NPTGSFKDRGMVMAVAKAKEEGAEAVICASTGNTSAAAAAYATRAGLKAYIVIPEGKVAL
GKLAQAVMYGADIISIQGNFDEALKSVRELAETEAVTLVNSVNPYRLEGQKTAAFEICEQ
LGSAPDVLAIPVGNAGNISAYWKGFKEWNEAKASGLPRMHGFEAEGAAAIVQGKPIDNPE
TIATAIRIGNPASWELAEAARDESGGYIHSVTDDEIVNAYKKIAAQDGVFIEPGSAASLA
GVIQHVANGTIKKGETVVCVFTGNGLKDPDTAMSVHEIPISHVDDIEAMRTHLRSGVKA
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atattccgttgtggagggttaaatatgtataaaggtttactagaaaaatataaagaatat
ctaccagtaactgataaaacaccaatgatctcacttgcggaaggaaatacaccacttatt
ccattaccgaatttgtccaaagaactgggtgttactttatacggaaaatatgaaggctta
aatccaaccggttcttttaaagaccgtggaatggttatggctgttgctaaagcgaaagaa
gaaggtgccgaagcggttatttgtgcatccactgggaatacttctgctgcggctgcggca
tacgcaacacgtgcgggattaaaagcgtacattgttattccagaaggcaaagtcgctcta
ggaaaattagcgcaagcagttatgtacggcgcagatattatctcaattcaaggtaatttt
gatgaagcgttaaaatcggttcgtgaactggctgaaacagaagcagtaacgcttgtaaac
tcggtaaatccttatcgtttagaaggtcaaaaaacagctgcattcgaaatttgtgagcaa
ttaggttctgctccagatgtccttgcaatcccagtaggtaatgccggaaacatttctgcc
tactggaaagggtttaaagagtggaatgaggccaaggcttctggacttccacggatgcat
ggttttgaagcggaaggtgcggctgcgattgttcaaggtaaaccgattgataatccggaa
acaattgcaacggcgattcgtatcggaaatccagctagttgggagcttgcagaagcagct
cgcgatgaatctggcggatatatccattctgtaacagatgatgaaattgtaaatgcgtat
aaaaaaattgcagcacaagatggtgtctttatcgagccaggttcagccgcttcattagct
ggtgtcatccaacatgtagcaaatggaacaattaaaaaaggcgaaacagtagtttgtgtc
tttactggaaacggcttgaaagatccggatactgcgatgagtgtgcatgaaattccaatt
tctcatgtggatgatatcgaagcaatgcgcacacatttacgttcaggagtgaaagcttaa

DBGET integrated database retrieval system