KEGG   Listeria monocytogenes serotype 4b LL195: BN389_25080Help
Entry
BN389_25080       CDS       T02416                                 

Gene name
thrC
Definition
(GenBank) Threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
lmog  Listeria monocytogenes serotype 4b LL195
Pathway
lmog00260  Glycine, serine and threonine metabolism
lmog00750  Vitamin B6 metabolism
lmog01100  Metabolic pathways
lmog01110  Biosynthesis of secondary metabolites
lmog01120  Microbial metabolism in diverse environments
lmog01230  Biosynthesis of amino acids
Module
lmog_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:lmog00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BN389_25080 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BN389_25080 (thrC)
Enzymes [BR:lmog01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BN389_25080 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Peripla_BP_6 PK_C
Motif
Other DBs
NCBI-ProteinID: CCO65082
UniProt: A0A0E1R8R4
Position
complement(2576308..2577387)
Genome map
AA seq 359 aa AA seqDB search
MFRCGGLNMYKGLLEKYKEYLPVTDKTPMISLAEGNTPLIPLPNLSKELGVTLYGKYEGL
NPTGSFKDRGMVMAVAKAKEEGAEAVICASTGNTSAAAAAYATRAGLKAYIVIPEGKVAL
GKLAQAVMYGADIISIQGNFDEALKSVRELAETEAVTLVNSVNPYRLEGQKTAAFEICEQ
LGSAPDVLAIPVGNAGNISAYWKGFKEWNEAKASGLPRMHGFEAEGAAAIVQGKPIDNPE
TIATAIRIGNPASWELAEAARDESGGYIHSVTDDEIVNAYKKIAAQDGVFIEPGSAASLA
GVIQHVANGTIKKGETVVCVFTGNGLKDPDTAMSVHEIPISHVDDIEAMRTHLRSGVKA
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atattccgttgtggagggttaaatatgtataaaggtttactagaaaaatataaagaatat
ctaccagtaactgataaaacaccaatgatctcacttgcggaaggaaatacaccacttatt
ccattaccgaatttgtccaaagaactgggtgttactttatacggaaaatatgaaggctta
aatccaaccggttcttttaaagaccgtggaatggttatggctgttgctaaagcgaaagaa
gaaggtgccgaagcggttatttgtgcatccactgggaatacttctgctgcggctgcggca
tacgcaacacgtgcgggattaaaagcgtacattgttattccagaaggcaaagtcgctcta
ggaaaattagcgcaagcagttatgtacggcgcagatattatctcaattcaaggtaatttt
gatgaagcgttaaaatcggttcgtgaactggctgaaacagaagcagtaacgcttgtaaac
tcggtaaatccttatcgtttagaaggtcaaaaaacagctgcattcgaaatttgtgagcaa
ttaggttctgctccagatgtccttgcaatcccagtaggtaatgccggaaacatttctgcc
tactggaaagggtttaaagagtggaatgaggccaaggcttctggacttccacggatgcat
ggttttgaagcggaaggtgcggctgcgattgttcaaggtaaaccgattgataatccggaa
acaattgcaacggcgattcgtatcggaaatccagctagttgggagcttgcagaagcagct
cgcgatgaatctggcggatatatccattctgtaacagatgatgaaattgtaaatgcgtat
aaaaaaattgcagcacaagatggtgtctttatcgagccaggttcagccgcttcattagct
ggtgtcatccaacatgtagcaaatggaacaattaaaaaaggcgaaacagtagtttgtgtc
tttactggaaacggcttgaaagatccggatactgcgatgagtgtgcatgaaattccaatt
tctcatgtggatgatatcgaagcaatgcgcacacatttacgttcaggagtgaaagcttaa

DBGET integrated database retrieval system